close all open/close all

CDS information : Dynm_00560


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction68,795 / 69,451 / + [in whole cluster]
68,795 / 69,451 / + [in contig]
Location68795..69451 [in whole cluster]
68795..69451 [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF41
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPRRVVACAVMKLAPVRVSTRTPSVARRWRLLGAATLAVALCAGYPSVTMGHRLDHGSSW
WHGADAETLTEGPRTEIRFAFSPRGQITFGASIRNPGPWPVTITGVAVNDGPADQHVFKV
VRLAVNHTAEANAMFDPDAATPFRSMRVGAGTELPVFVTITIPDVEMAPGSGLFFDNLAV
AYTVLGLPRHQRVPMGFRLSVLSPDGYVPDDARNQPRD
selected fasta
>hypothetical protein [hypothetical protein]
GTGCCGAGGCGCGTTGTAGCGTGCGCTGTCATGAAGCTGGCGCCGGTGCGCGTATCCACC
CGGACGCCCTCTGTGGCACGTCGCTGGCGGTTGCTGGGCGCCGCGACGCTGGCTGTCGCG
CTGTGCGCCGGGTACCCGTCGGTGACCATGGGGCATCGCCTCGACCACGGCAGTTCGTGG
TGGCACGGGGCCGACGCGGAGACCCTCACCGAAGGGCCCAGGACGGAGATTCGGTTCGCC
TTCAGCCCCCGAGGGCAGATCACATTCGGTGCGTCCATCCGCAATCCCGGCCCGTGGCCG
GTGACGATCACCGGCGTCGCGGTCAACGACGGCCCCGCTGACCAGCACGTGTTCAAGGTC
GTCCGCCTGGCGGTCAACCACACCGCCGAGGCCAACGCCATGTTCGACCCGGATGCGGCG
ACACCCTTCCGGTCGATGAGAGTGGGGGCGGGCACGGAGTTGCCGGTCTTCGTCACGATC
ACGATCCCGGACGTGGAGATGGCTCCCGGTTCAGGGCTGTTCTTCGACAACCTCGCGGTC
GCCTACACGGTGCTCGGCCTGCCTCGCCACCAGCGGGTGCCGATGGGCTTCCGCCTGTCG
GTCCTCTCCCCGGACGGCTACGTTCCCGACGACGCCCGGAACCAGCCCCGGGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-66]  0.511 Signal
Bacteria, Gram-positive   
TMHMM No significant hit