close all open/close all

CDS information : Dynm_00570


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction69,668 / 70,093 / + [in whole cluster]
69,668 / 70,093 / + [in contig]
Location69668..70093 [in whole cluster]
69668..70093 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF42
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MNMSQYFQAGDLVLWNPSNRVAELFVRTSNAVADLVDRPTGIGPMQADEYDIDLDVFADF
VDALVAQYLSSSHTILRSLLEGFTATALVLVDRAGRSVRSLQATATLDPRDVSVGAGGIR
PLGDPARLHELASTHAAAMPV
selected fasta
>hypothetical protein [hypothetical protein]
GTGAATATGAGTCAGTACTTTCAGGCGGGCGACCTCGTCCTGTGGAACCCTTCAAACCGG
GTGGCCGAGTTGTTCGTCCGGACCAGCAACGCGGTCGCCGACCTGGTTGACAGACCGACC
GGGATCGGGCCCATGCAGGCCGACGAGTACGACATCGACCTCGACGTGTTCGCCGATTTC
GTGGATGCGCTGGTGGCGCAGTACCTGTCCTCGAGCCACACGATCCTCAGGTCCTTGCTG
GAAGGCTTCACCGCCACCGCGCTCGTTCTCGTTGACCGCGCCGGCCGAAGCGTCCGCTCG
CTCCAGGCCACTGCCACGCTGGACCCGAGGGACGTTTCCGTCGGCGCAGGAGGAATCCGC
CCGCTGGGCGACCCCGCCCGTCTCCACGAGCTCGCCAGCACGCACGCCGCAGCCATGCCA
GTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit