close all open/close all
Dynm_00580 Dynm_00580   last last

CDS information : Dynm_00590


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction74,911 / 71,495 / - [in whole cluster]
74,911 / 71,495 / - [in contig]
Locationcomplement(71495..74911) [in whole cluster]
complement(71495..74911) [in contig]
TypeCDS
Length3,417 bp (1,138 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative restriction-modification system restriction subunit
putative restriction enzyme R protein
Product (GenBank)type I site-specific deoxyribonuclease protein R
Geneorf27
Gene (GenBank)
EC number3.1.21.-
Keyword
Note
Note (GenBank)
  • ORF44
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
P08956
PmId
[3323532] Organization and sequence of the hsd genes of Escherichia coli K-12. (J Mol Biol. , 1987)
Family/Domain
FD
IPR007409

close this sectionSequence

selected fasta
>putative restriction-modification system restriction subunit [type I site-specific deoxyribonuclease protein R]
MSNFAFLRAEWPVLFGEALRAERLAVADPRASCFYARRSLELALTWLFEADSTLNKPYKD
DLSAMIHEPSLRNLVGNSLQAKMNIIRKQGNTAVHKSTPVTPKEAVPVVRELFHVMYWIA
RHYTRDQAKVPASALAFNPDLIPRPVPSQVRQQTQAELKALADKLAAQDAALAAEREKSA
TLDAELAKLRAEIAAAKAANEARPDDHDYDEAQTRDLFIDLMLREAGWRLDRPEDREFEV
TGMPNGTGTGYVDYVLWGDDGKPLAVVEAKRTRRDATVGQQQAKLYADCLEQRYGQRPVI
FYTNGYETWLWDDTAYPPRPVQGFYTKDELHLLIQRRDTRKPLADVPINLEIVERYYQHR
AIRAIGEAFETQRQRQALVVMATGAGKTRTVIALVDLLMRANWVKRVLFLADRNALVNQA
VNAFKAHLPDAATVNLVTEKNTEGRVYVSTYPTMMGLINETASGERRFGPGYFDLVIIDE
AHRSVYQKYRAIFSWFDSLLVGLTATPRNEIDRNTYSLFNLEDGVPTDHYDLDDAVNEGF
LVPPRAVSVPLKFQRDGIRYDDLTEEEKDDWDAIDWGEDGPPDSVDPDAVNKWLFNADTV
DKVLETLMTHGHHVAGGDRIGKTIIFAKNNAHADFIQKRFDLAYPMHRGHLARVITHKTE
YAQSLIDAFSEKEKDPHIAVSVDMLDTGIDVPEVVNLVFFKIVRSKSKFWQMIGRGTRLC
KDLYGPDQHKQDFFIFDFCQNFEFFNHNPKAAEGTLGESLTERLFKAQLELIYRLDQRIP
CDAGAETEADGTQSEAALRWDLARNLHRRVENIHLDNFVVRPKRRLVQYYVDFEHWHRLT
PEAVDEIGSNLAGLPTAVKDEDEAAKRFDLLVLRLQLGQLDVEPAYDRLRRQVQDIASTL
LEQTSIPAVREQQQLLDEVAGDEWWQDITLPMLELMRRRLRGLVKLIERSKRAIVYTDFT
DELGEISVVTLNDIKIGTEFERFRAKARVYLRAHEDHLALQKLRRNKQLSPTDLDELERM
LAASGGGTEDIDEARRSAHGLGLFIRSLVGLDREAATEAFGEFLAGRTLTANQINFVNLI
ITHLTQNGVMEPARLYESPFSDIAPHGPDSIFPSADVDHLITILNSVRDTAAPAAEVA
selected fasta
>putative restriction-modification system restriction subunit [type I site-specific deoxyribonuclease protein R]
ATGAGCAACTTCGCGTTCCTGCGGGCTGAGTGGCCCGTGCTGTTTGGCGAGGCCCTGCGG
GCGGAGCGGCTGGCCGTCGCTGATCCGCGGGCCTCGTGCTTCTACGCCCGGCGGTCGCTC
GAACTCGCGCTTACCTGGCTCTTCGAGGCTGACAGCACGCTGAACAAGCCGTACAAGGAC
GACCTGTCGGCGATGATCCACGAGCCGTCGCTGCGCAACCTGGTGGGCAACAGCCTGCAG
GCGAAGATGAACATCATCCGCAAGCAGGGCAACACGGCCGTCCACAAGAGCACGCCGGTG
ACGCCGAAGGAGGCGGTGCCGGTCGTCCGCGAGCTGTTCCACGTCATGTACTGGATCGCC
CGGCACTACACCCGCGACCAGGCCAAGGTGCCGGCCAGCGCGCTCGCCTTCAACCCGGAC
CTCATCCCCCGGCCGGTTCCCTCGCAGGTCCGGCAGCAGACCCAGGCTGAGCTCAAGGCG
CTGGCTGACAAGCTCGCCGCCCAGGATGCGGCGCTGGCGGCCGAGCGGGAGAAGTCCGCG
ACCCTCGACGCTGAGTTGGCGAAGCTGCGGGCCGAGATCGCCGCCGCGAAGGCCGCCAAC
GAGGCCCGCCCCGACGACCACGACTACGACGAGGCGCAGACCCGCGACCTCTTCATCGAC
CTCATGCTGCGGGAGGCCGGCTGGCGCCTCGACCGCCCGGAGGACCGCGAGTTCGAGGTC
ACCGGCATGCCCAATGGCACGGGCACCGGGTACGTCGACTACGTCCTGTGGGGTGACGAC
GGCAAGCCGCTCGCGGTGGTCGAGGCCAAGCGCACCCGCCGGGACGCCACCGTCGGTCAG
CAGCAGGCCAAGCTGTACGCCGACTGCCTGGAGCAGCGGTACGGCCAGCGGCCGGTCATC
TTCTACACCAACGGCTACGAGACCTGGCTCTGGGACGACACCGCCTACCCTCCCCGCCCG
GTGCAGGGCTTCTACACCAAGGATGAGCTCCACCTGCTGATCCAGCGCCGCGACACCCGC
AAGCCGCTCGCGGACGTGCCCATCAACCTGGAGATCGTCGAGCGGTACTACCAGCACCGG
GCGATCCGGGCCATCGGCGAGGCGTTCGAGACGCAGCGGCAGCGCCAGGCGCTTGTCGTG
ATGGCCACCGGCGCCGGCAAGACCCGCACCGTGATTGCCCTGGTCGATCTGCTGATGCGC
GCGAACTGGGTCAAGCGGGTGCTCTTCCTCGCCGACCGCAACGCGCTGGTTAACCAGGCG
GTCAACGCGTTCAAGGCGCACCTGCCGGACGCGGCGACGGTCAACCTGGTCACCGAGAAG
AACACCGAGGGTCGGGTGTACGTCTCGACGTACCCGACCATGATGGGCCTGATCAACGAG
ACCGCGAGCGGTGAGCGTCGCTTCGGCCCCGGCTACTTCGACCTGGTCATCATCGACGAG
GCGCACCGGTCGGTCTACCAGAAGTACCGGGCGATCTTCTCCTGGTTCGACAGCCTCCTC
GTCGGGCTCACCGCGACCCCGCGCAACGAGATCGACCGCAACACCTACAGCCTGTTCAAC
CTGGAAGACGGCGTTCCCACCGACCACTACGACCTCGACGACGCGGTCAACGAGGGCTTC
CTTGTGCCGCCGCGGGCGGTCTCCGTACCGTTGAAGTTCCAGCGCGACGGCATCCGGTAC
GACGACCTCACCGAGGAGGAGAAGGACGACTGGGACGCCATCGACTGGGGTGAGGACGGA
CCGCCGGACAGCGTCGACCCGGACGCGGTCAACAAGTGGCTGTTTAACGCCGACACCGTG
GACAAGGTGCTGGAGACGTTGATGACCCACGGCCATCACGTCGCGGGCGGCGACCGGATC
GGCAAGACCATCATCTTTGCCAAGAACAACGCCCACGCGGACTTCATCCAGAAGCGGTTC
GACCTCGCGTACCCGATGCACCGAGGCCACCTGGCCCGGGTCATCACCCACAAGACCGAG
TACGCCCAGAGCCTCATCGACGCCTTCTCGGAGAAGGAGAAGGACCCGCACATCGCGGTC
TCGGTGGACATGCTCGACACCGGCATCGACGTGCCCGAGGTCGTCAACCTGGTCTTCTTC
AAGATCGTGCGGTCGAAGTCGAAGTTCTGGCAGATGATCGGCCGCGGCACCCGTCTCTGC
AAGGACCTCTACGGTCCCGACCAGCACAAGCAGGACTTCTTCATCTTCGACTTCTGCCAG
AACTTCGAGTTCTTCAACCACAACCCGAAGGCGGCCGAGGGCACGCTGGGCGAGTCGCTG
ACCGAGCGGCTGTTCAAGGCCCAGCTCGAACTGATCTACCGCCTCGACCAGCGAATCCCC
TGCGACGCCGGCGCCGAGACGGAGGCCGACGGGACGCAGAGCGAGGCGGCGCTGCGCTGG
GACCTCGCCCGCAACCTGCACCGCCGGGTGGAGAACATCCACCTCGACAACTTCGTCGTA
CGCCCCAAGCGGCGCCTGGTGCAGTACTACGTCGACTTCGAGCACTGGCACCGGCTCACC
CCCGAGGCGGTGGACGAGATCGGCAGCAACCTCGCCGGCCTGCCCACCGCCGTGAAGGAC
GAGGACGAGGCCGCCAAGCGGTTCGACCTGCTGGTGCTGCGCCTCCAGCTCGGCCAGCTC
GACGTGGAACCCGCCTACGACCGGCTGCGCCGGCAGGTGCAGGACATCGCCTCGACGCTG
CTGGAGCAGACCAGCATCCCGGCGGTCCGCGAGCAGCAGCAACTCCTCGACGAGGTGGCC
GGCGACGAGTGGTGGCAGGACATCACCCTGCCGATGCTGGAGCTGATGCGCCGCCGTCTC
CGTGGGCTGGTCAAGCTGATCGAGAGGTCCAAGCGGGCCATCGTCTACACCGACTTCACC
GACGAGCTGGGCGAGATCTCCGTCGTCACGTTGAATGACATCAAGATCGGCACGGAGTTC
GAGCGGTTCCGCGCGAAGGCCCGGGTGTACCTGCGCGCTCACGAGGATCACCTGGCGTTG
CAGAAGCTGCGCCGCAACAAGCAGCTTTCCCCGACCGACCTCGATGAGCTGGAGCGGATG
CTGGCGGCCAGCGGCGGCGGCACGGAGGACATCGATGAGGCCCGCCGCTCGGCCCACGGG
CTCGGCCTGTTCATCCGCTCGCTGGTCGGACTCGACAGGGAAGCGGCCACCGAGGCGTTC
GGCGAGTTCCTGGCCGGCCGGACCCTGACCGCGAACCAGATCAACTTCGTCAACCTGATC
ATCACCCACCTCACGCAGAACGGCGTGATGGAGCCCGCGCGGCTCTACGAATCCCCGTTC
AGCGACATCGCCCCGCACGGGCCGGACTCGATCTTCCCGTCCGCCGACGTCGACCACCTG
ATCACGATCCTCAACTCCGTCCGAGACACCGCCGCCCCTGCCGCCGAGGTGGCTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001650 Helicase, C-terminal (Domain)
 [599-772]  PS51194
PS51194   HELICASE_CTER
 [663-718]  1.3e-06 PF00271
PF00271   Helicase_C
IPR006935 Helicase/UvrB domain (Domain)
 [353-508]  3.90000000000001e-31 PF04851
PF04851   ResIII
IPR007409 Restriction endonuclease, type I, HsdR, N-terminal (Domain)
 [236-316]  9.3e-08 PF04313
PF04313   HSDR_N
IPR013670 EcoEI R protein C-terminal domain (Domain)
 [979-1129]  1e-27 PF08463
PF08463   EcoEI_R_C
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [368-525]  PS51192
PS51192   HELICASE_ATP_BIND_1
 [350-543]  1.10000150671642e-20 SM00487
SM00487   DEXDc
IPR025285 Domain of unknown function DUF4145 (Domain)
 [21-106]  2.7e-09 PF13643
PF13643   DUF4145
SignalP No significant hit
TMHMM No significant hit
Dynm_00580 Dynm_00580   last last