close all open/close all
first first   Ello_00020 Ello_00020

CDS information : Ello_00010


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction3 / 404 / + [in whole cluster]
3 / 404 / + [in contig]
Location3..404 [in whole cluster]
3..404 [in contig]
TypeCDS
Length402 bp (133 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>[dehydrogenase]
MTTEPTRALLDDFDAAGGAGKPRMGQMPVSYDTDRDAALARAHEQFRWALGGWRLNAELP
LPPGFVQASEHTRPEDVAKSIPCGDDVDAVLEAAGRYAEAGFTDLALVQIGGDQQTPFIR
WAETTLLPALRDL
selected fasta
>[dehydrogenase]
ATCACCACGGAGCCGACCCGTGCGCTCCTCGACGACTTCGACGCCGCGGGCGGCGCGGGC
AAGCCCCGGATGGGCCAGATGCCCGTGAGCTACGACACCGACCGGGACGCGGCCCTGGCC
CGTGCCCACGAGCAGTTCCGGTGGGCGCTGGGCGGCTGGCGCCTGAACGCCGAGCTCCCG
CTGCCGCCGGGGTTCGTCCAGGCGTCCGAGCACACCCGGCCGGAGGACGTGGCGAAGAGC
ATCCCCTGCGGAGACGACGTGGACGCCGTCCTGGAGGCGGCCGGCCGCTACGCCGAGGCC
GGGTTCACCGACCTCGCCCTCGTCCAGATCGGCGGTGACCAGCAGACGCCCTTCATCCGG
TGGGCGGAGACGACCCTGCTGCCCGCCCTCCGCGACCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [11-131]  9.9e-11 G3DSA:3.20.20.30
G3DSA:3.20.20.30   no description
 [2-132]  9.6e-11 SSF51679
SSF51679   Bacterial luciferase-like
 [7-103]  4.5e-06 PF00296
PF00296   Bac_luciferase
SignalP
 [1-8]  0.106 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Ello_00020 Ello_00020