close all open/close all

CDS information : Ello_00020


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction414 / 1,085 / + [in whole cluster]
414 / 1,085 / + [in contig]
Location414..1085 [in whole cluster]
414..1085 [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)phosphatase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>[phosphatase]
MDRAALFDVDGTLVDTNHLHVVAWWEALRQGGHRVPTHAVHRAIGLPGDQLIEHLLDPSR
DRSDDARLSAAHDTLYGTSFERLQAFDRTAELLRTLAGDGWKVVLVTSAKDRELGALRRA
IDADDALTQTATADDVEQGKPAPDPLLHALSLVGVPAERAVFVGDSVWDMKAARHADVVC
AGLLCGGIPRADLTEAGAAAVYDDPADLLAHLSTSPFAAVPKA
selected fasta
>[phosphatase]
ATGGACCGCGCCGCGCTCTTCGACGTCGACGGGACCCTGGTCGACACCAACCATCTGCAT
GTCGTCGCCTGGTGGGAGGCGCTCCGGCAGGGCGGCCACCGGGTGCCGACGCACGCCGTG
CACCGCGCCATCGGCCTGCCGGGGGACCAGCTCATCGAGCACCTGCTGGACCCGTCCCGC
GACCGCTCCGACGACGCGCGTCTCAGCGCCGCCCACGACACCCTCTACGGCACCTCCTTC
GAGCGCCTGCAGGCCTTCGACAGGACGGCGGAGCTGCTGCGCACCCTCGCGGGCGACGGC
TGGAAGGTCGTCCTGGTGACCTCGGCCAAGGACCGGGAACTGGGCGCCCTGCGCCGGGCC
ATCGACGCCGACGACGCCCTCACCCAGACCGCGACCGCCGACGACGTCGAACAGGGCAAG
CCGGCTCCCGATCCGCTCCTCCACGCCCTCTCGCTGGTCGGCGTGCCCGCCGAACGGGCC
GTGTTCGTCGGCGACAGCGTCTGGGACATGAAGGCCGCGCGTCACGCCGACGTGGTCTGC
GCCGGGCTGCTGTGCGGCGGCATCCCGCGCGCCGACCTCACCGAGGCGGGCGCCGCCGCC
GTCTACGACGACCCCGCCGACCTCCTCGCGCACCTGTCCACCAGCCCCTTCGCGGCGGTC
CCGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [62-176]  8.40000000000001e-09 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [3-16]  2.4e-36 G3DSA:3.40.50.1000 [82-213]  2.4e-36 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [1-212]  1.10000150671643e-46 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit