close all open/close all

CDS information : Ello_00030


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction1,169 / 1,720 / + [in whole cluster]
1,169 / 1,720 / + [in contig]
Location1169..1720 [in whole cluster]
1169..1720 [in contig]
TypeCDS
Length552 bp (183 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>[membrane protein]
MTTTRRLTEAEWRTVQEETAPAPPPRSSEGARERVNRRWQEVLQETRVAQTGVQILFGFL
LSLAFTPRFRELGSFDRGLYVVTVVLAASSTAALIAPVTLHRCLSGQRLKDEVVTAAGRL
MVCGIVLLALTVACTLMLILNVVLGGVLPAGIVVGGVMLWFALCWYGAAYRVRRRAQQRI
RER
selected fasta
>[membrane protein]
ATGACCACGACGAGACGCCTGACGGAGGCCGAGTGGCGCACCGTACAGGAGGAGACCGCT
CCCGCCCCGCCGCCGCGCTCGTCGGAAGGCGCCCGCGAGCGGGTCAACAGACGCTGGCAG
GAAGTCCTCCAGGAGACCCGGGTCGCCCAGACCGGCGTGCAGATCCTGTTCGGCTTCCTG
CTGAGCCTCGCCTTCACCCCGCGCTTTCGTGAACTGGGCTCCTTCGACCGCGGACTGTAC
GTCGTGACGGTCGTCCTCGCCGCCTCCTCGACGGCCGCCCTCATCGCACCGGTCACCCTC
CACCGCTGTCTCTCCGGGCAGCGGCTGAAGGACGAGGTCGTGACCGCCGCCGGACGCCTC
ATGGTCTGCGGCATCGTGCTCCTCGCGCTGACCGTCGCCTGCACGCTCATGCTCATCCTG
AACGTGGTCCTCGGCGGGGTGCTCCCGGCCGGGATCGTCGTCGGCGGCGTGATGCTGTGG
TTCGCCCTCTGCTGGTACGGAGCCGCCTACCGGGTGCGCCGCAGGGCACAGCAACGGATC
CGAGAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [47-69]  Transmembrane (i-o) [79-101]  Transmembrane (o-i) [122-144]  Transmembrane (i-o) [148-170]  Transmembrane (o-i)
Transmembrane 4