close all open/close all

CDS information : Ello_00040


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction1,881 / 2,807 / + [in whole cluster]
1,881 / 2,807 / + [in contig]
Location1881..2807 [in whole cluster]
1881..2807 [in contig]
TypeCDS
Length927 bp (308 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)C12a O-methyltransferase
Gene
Gene (GenBank)elmD
EC number2.1.1.-
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Family/Domain
FD
IPR007213, IPR011610

close this sectionSequence

selected fasta
>putative methyltransferase [C12a O-methyltransferase]
MTAKYEEWDISVSVGLTALAACSARAVESDRPDRLIEDPYARDLVLAARKPRPLPTSLAE
ADKAAGSMMTSRFTGVRSRVFDDFFAAAGRSGIRQAVVLAAGLDARAFRLPWPSGTVVYE
IDQPGVLRYKEEVMAHLGVTPTCVRRPVGRDLRTDWASGLGAAGFDPTRPTAWIGEGLLP
YLPAEAEAEMFASIRALSAPGSRLCVEFMPAEVVARFAAHPTMRGTSDSLGVDIGEMWNS
EPRQAAADRLRETGWNVTVDTVLDRARELGAPLDEEFAGIVDMLGVPRESPLAATFGACA
FVAAELPA
selected fasta
>putative methyltransferase [C12a O-methyltransferase]
ATGACTGCCAAGTACGAAGAGTGGGACATCAGTGTCAGTGTGGGTTTGACGGCTCTCGCC
GCGTGTTCGGCGCGTGCGGTGGAGAGTGACCGGCCCGACCGGCTCATCGAAGACCCTTAC
GCGAGGGATCTGGTGCTCGCCGCCCGAAAGCCCAGGCCGCTTCCGACGTCGTTAGCGGAG
GCCGACAAAGCCGCGGGTTCGATGATGACGTCGCGTTTCACCGGGGTGCGTTCCCGGGTC
TTCGACGACTTCTTCGCCGCGGCGGGACGGTCCGGCATACGCCAGGCCGTCGTGCTCGCG
GCCGGCCTCGACGCCCGTGCGTTCCGGCTGCCCTGGCCGTCCGGCACGGTCGTGTACGAG
ATCGACCAGCCCGGCGTCCTGCGGTACAAGGAGGAGGTCATGGCGCATCTGGGCGTCACG
CCGACCTGTGTCCGGCGCCCGGTGGGCCGGGACCTGCGCACCGACTGGGCGAGCGGCCTC
GGAGCCGCCGGCTTCGACCCGACCCGGCCCACGGCATGGATCGGCGAGGGGCTCCTCCCG
TATCTGCCGGCCGAGGCCGAGGCCGAGATGTTCGCGTCGATCAGGGCCCTCTCCGCACCC
GGCAGCCGGTTGTGCGTGGAGTTCATGCCGGCCGAGGTCGTCGCACGCTTCGCCGCCCAT
CCGACCATGCGGGGCACGAGCGACTCGCTCGGTGTCGACATCGGCGAGATGTGGAACTCC
GAGCCCCGCCAGGCCGCCGCCGACCGGCTGCGGGAAACCGGCTGGAACGTGACGGTCGAC
ACGGTCCTCGACCGTGCCCGTGAGCTCGGGGCGCCGCTCGACGAGGAGTTCGCCGGAATC
GTCGACATGCTGGGCGTGCCCAGGGAGAGCCCGCTCGCCGCGACCTTCGGCGCCTGTGCG
TTCGTGGCCGCCGAACTGCCTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007213 Leucine carboxyl methyltransferase (Family)
 [18-194]  2.4e-48 PF04072
PF04072   LCM
IPR011610 S-adenosyl-L-methionine-dependent methyltransferase, putative (Family)
 [16-270]  1.4e-75 TIGR00027
TIGR00027   mthyl_TIGR00027: putative methyltransferase, TIGR0
SignalP No significant hit
TMHMM No significant hit