close all open/close all

CDS information : Ello_00050


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction3,099 / 4,658 / + [in whole cluster]
3,099 / 4,658 / + [in contig]
Location3099..4658 [in whole cluster]
3099..4658 [in contig]
TypeCDS
Length1,560 bp (519 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)elloramycin permease
Gene
Gene (GenBank)elmE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q0R4N5
NITE
Chth_00190
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter [elloramycin permease]
MASIDSGLGAAQAGDTASHPTKLDGPLLKVAAAVIAGSIMAILDTTVVTIALQSLIVEFH
TSFDTVQWVTTAYMLALAAVIPVTGWAADRFGTKRLYALALTLFLVGSVLAGFAWNIGSM
IAFRVLQGLGGGILTPAGMTVLAKAAGPARVGRVMSLLGVPMLLGPLAGPIVGGWLVDSG
GWRWIFYLNVPIGLLALALTLRYLPKDTETTGGALDTVGTLLLSPGVALVLYGVSGIPRS
GGITPGVWLPVALGLLMIAGFVVRAQRIEHPLLDLSLFRNRRFSLAVVTMALFAVAFFGV
SILLPTEFLMVRQLSALETGMQLLPLGIGAVVTMPLSGRLADRVGPGKVVVPGLLLIAAG
ITVFTQAGPDSGYATVLAPGLFVIGLGVGATMMPIISAALQVLDGPAVARGSTMANIIQQ
GFGAIGSAVMSIVLAAGLAGRFDVPVSQGQLVATTALADPARHATALGMVSDTFTTTFVW
SLALVILCLVPACFLWRKPAEAVSAPVPRLKAGTVDGLS
selected fasta
>putative drug resistance transporter [elloramycin permease]
ATGGCGTCAATCGACTCCGGCCTGGGCGCTGCCCAGGCCGGTGACACCGCTTCCCACCCC
ACCAAGCTCGACGGCCCGCTGCTCAAGGTCGCGGCCGCCGTGATCGCCGGATCGATCATG
GCGATCCTGGACACGACCGTCGTGACGATCGCGCTGCAGAGCCTGATCGTCGAGTTCCAC
ACCTCGTTCGACACCGTCCAGTGGGTCACCACCGCCTACATGCTGGCTCTGGCCGCGGTG
ATCCCCGTGACCGGCTGGGCCGCCGACCGCTTCGGTACGAAGCGGCTGTACGCGCTCGCG
CTCACGCTGTTCCTGGTCGGCTCGGTCCTGGCCGGGTTCGCCTGGAACATCGGCTCGATG
ATCGCGTTCCGCGTCCTCCAGGGCCTGGGCGGCGGCATCCTCACCCCGGCCGGCATGACG
GTCCTGGCCAAGGCGGCGGGCCCCGCCAGGGTCGGGCGCGTCATGTCGCTGCTGGGCGTC
CCGATGCTGCTCGGCCCGCTGGCGGGGCCGATCGTCGGCGGCTGGCTCGTCGACTCCGGC
GGCTGGCGCTGGATCTTCTACCTCAACGTGCCCATCGGCCTGCTCGCCCTCGCCCTGACC
CTGCGCTACCTGCCCAAGGACACGGAGACGACCGGCGGCGCGCTCGACACGGTCGGCACC
CTCCTGCTGTCGCCCGGGGTGGCCCTCGTGCTCTACGGCGTGTCCGGCATCCCGCGGTCC
GGTGGCATCACCCCCGGGGTGTGGCTTCCGGTCGCCCTCGGCCTGCTCATGATCGCGGGC
TTCGTCGTCCGGGCCCAACGGATCGAGCACCCGCTGCTCGACCTCTCCCTCTTCCGCAAC
CGACGTTTCTCCCTCGCCGTCGTCACAATGGCGCTCTTCGCGGTCGCCTTCTTCGGGGTC
AGCATCCTGCTGCCCACCGAGTTCCTGATGGTGCGTCAACTCAGTGCGCTGGAAACCGGC
ATGCAGCTGCTGCCGCTCGGCATCGGCGCGGTCGTGACCATGCCGCTGTCCGGCCGGCTC
GCCGACCGCGTCGGGCCCGGCAAGGTCGTCGTACCCGGTCTGCTGCTGATCGCGGCCGGC
ATCACCGTCTTCACCCAGGCCGGTCCCGACAGCGGGTACGCGACCGTGCTCGCCCCCGGG
CTCTTCGTCATCGGCCTCGGCGTCGGCGCCACGATGATGCCGATCATCTCCGCGGCGCTC
CAGGTCCTGGACGGGCCCGCCGTCGCGCGGGGGTCGACCATGGCCAACATCATCCAGCAG
GGGTTCGGCGCCATCGGGTCCGCGGTGATGTCGATCGTGCTCGCGGCCGGGCTCGCCGGC
CGGTTCGACGTCCCCGTCAGCCAGGGGCAGTTGGTCGCCACCACGGCGCTGGCCGATCCC
GCGCGGCACGCGACCGCGCTCGGCATGGTCTCCGACACCTTCACCACGACCTTCGTCTGG
TCACTGGCCCTCGTGATCCTGTGCCTGGTGCCCGCCTGCTTCCTGTGGCGGAAGCCGGCC
GAGGCCGTCTCCGCGCCGGTGCCCCGCCTGAAGGCGGGTACTGTTGACGGCCTTTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [30-435]  1.10000000000001e-110 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [36-426]  9.50000000000005e-55 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [5-501]  5.20000089003336e-75 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [30-500]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [34-56]  Transmembrane (i-o) [66-88]  Transmembrane (o-i) [95-117]  Transmembrane (i-o) [121-143]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [217-236]  Transmembrane (i-o) [241-263]  Transmembrane (o-i) [283-305]  Transmembrane (i-o) [320-342]  Transmembrane (o-i) [349-368]  Transmembrane (i-o) [378-400]  Transmembrane (o-i) [421-440]  Transmembrane (i-o) [474-496]  Transmembrane (o-i)
Transmembrane 14