close all open/close all

CDS information : Ello_00060


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction4,676 / 5,875 / + [in whole cluster]
4,676 / 5,875 / + [in contig]
Location4676..5875 [in whole cluster]
4676..5875 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ElmF protein
Gene
Gene (GenBank)elmF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [ElmF protein]
MTTTAEQQITWTDGDGRTRTSLWHSENGAAPPRRIVPVDDRITADAAYRMAVEGTALLWT
GDFHNARQLLSALRRRIERRPRRSAQDPRVAFNQHRQAQAFRSRVLSSLLVPVDEGAVLA
LRRAPDIRDACAEAGCPLDRPFVCSLHALLGMTGAREWRRKGVEVPALGGARIHPRYGVF
APQRGEYVDLVARATLPDTGARPLVAFDIGTGTGVLAAVLARRGVPEVVATDLNPRALAC
ARENLDRLGLAERVTVMEADLFPPRRRASLVVCNPPWLPAKPTSELESAVYDPGGRMLRA
FLERLPRHLEPGGEAWLVLSDLAEHLGLRSREELLGLFAESGLAVRDRLDTRPRHGKADD
ASDALHDARSREVTSLWRLVLLRDLPEPVGDQTTRTGSG
selected fasta
>hypothetical protein [ElmF protein]
GTGACCACCACCGCTGAACAGCAGATCACCTGGACCGACGGGGACGGACGCACCCGCACC
TCCTTATGGCACTCCGAGAACGGGGCCGCCCCGCCGCGCCGGATCGTCCCCGTCGACGAC
CGGATCACGGCGGACGCCGCCTACCGCATGGCGGTGGAAGGCACCGCGCTGTTATGGACC
GGCGACTTCCACAACGCCCGTCAGCTGCTGTCGGCGCTGCGGCGCAGGATCGAACGCCGC
CCGCGACGCTCCGCCCAGGACCCCCGGGTCGCCTTCAACCAGCACCGGCAGGCCCAGGCG
TTCAGGTCCAGGGTCCTCTCCAGCCTCCTGGTCCCGGTCGACGAGGGCGCGGTCCTGGCG
CTGCGCCGTGCCCCCGACATCCGCGACGCCTGCGCCGAGGCGGGATGTCCGCTCGACCGG
CCCTTCGTCTGCTCCCTGCACGCACTGCTCGGCATGACCGGCGCCCGTGAATGGCGCCGC
AAGGGCGTCGAGGTGCCGGCCCTGGGCGGGGCGCGCATCCACCCCCGGTACGGGGTCTTC
GCGCCGCAGCGCGGGGAGTACGTGGATCTCGTGGCACGGGCGACGCTCCCCGACACCGGT
GCGCGGCCGTTGGTCGCCTTCGACATCGGGACCGGAACGGGCGTGCTGGCGGCGGTGCTT
GCCCGGCGCGGGGTCCCCGAGGTCGTCGCCACCGACCTCAACCCGCGGGCACTCGCCTGC
GCGCGGGAGAACCTCGACCGGCTCGGGCTAGCCGAGCGGGTCACCGTCATGGAAGCCGAC
CTCTTTCCACCGAGACGCCGTGCCTCCCTCGTCGTGTGCAACCCGCCGTGGCTGCCGGCC
AAGCCGACCTCCGAACTGGAGTCGGCGGTGTACGACCCGGGCGGCCGGATGCTGCGCGCC
TTCCTCGAGCGGCTGCCACGCCACCTCGAACCCGGGGGTGAAGCCTGGCTCGTCCTGTCC
GACCTCGCCGAGCACCTCGGTCTGCGCAGTCGCGAAGAACTGCTCGGCCTGTTCGCGGAG
TCCGGCCTCGCCGTGCGGGACCGGCTCGACACCCGGCCCCGGCACGGCAAGGCGGACGAC
GCGAGCGACGCCCTCCACGACGCGCGGTCCCGCGAGGTGACCTCGCTGTGGCGCCTGGTC
CTCCTCCGAGATCTTCCGGAGCCGGTAGGGGACCAAACCACCCGTACCGGCTCTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002052 DNA methylase, N-6 adenine-specific, conserved site (Conserved_site)
 [271-277]  PS00092
PS00092   N6_MTASE
SignalP No significant hit
TMHMM No significant hit