close all open/close all

CDS information : Ello_00070


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction6,162 / 7,781 / + [in whole cluster]
6,162 / 7,781 / + [in contig]
Location6162..7781 [in whole cluster]
6162..7781 [in contig]
TypeCDS
Length1,620 bp (539 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)TcmB2 oxygenase
Gene
Gene (GenBank)elmG
EC number
Keyword
  • C-4
  • C-4a
  • C-12a
Note
Note (GenBank)
Reference
ACC
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P39888
PmId
[8509339] Nucleotide sequences and heterologous expression of tcmG and tcmP, biosynthetic genes for tetracenomycin C in Streptomyces glaucescens. (J Bacteriol. , 1993)

close this sectionSequence

selected fasta
>hydroxylase [TcmB2 oxygenase]
MDRIEIPVLVVGGGLTGLAAAVFLRQQGVDCLLVERHRSTTFLTRASGINARTMELLRNA
GLEETVIDRSLHLIEGKRWRELGQPADRIPWVVLRARDLADIERAVIVEEPSLDVADVSP
TRAQWCGQDKLEPILRDEAVRRGADIRFHTRLDSFAQDADGVDAVIVDRGTGARTAVRSR
YLIAADGVRSTVRQALGVTGTGHGSLGKAMSVLFQADFEPVLHGRRFVITYMANPQAPGV
LQTFDENRWIFGFFCDAYGGGDAAFDTGRCADIVRTSLGIPDIPLDVQLVQPWEMSHHVA
DSYRSGRVFLAGDAAHVHPPAGAFGANGGIQDAHNLAWKLASVLHGRASDALLDTYHQER
HPVGTEIAEQAWTRHTYRLDGDDELGRRLVDTKVVAAGYRYTSSAVLGAAYPTAIPHELA
LTGLPGQRVPHVWLDHDGRRVSTVDLAVDGFVLLARADGTPWADAAARLAATTGIPLTAH
VVGKTLTDPADALAAATGLGEAGALLLRPDGFVAWRSDTSADDPEAVLDGVLARILART
selected fasta
>hydroxylase [TcmB2 oxygenase]
ATGGACCGAATAGAAATTCCCGTACTCGTCGTGGGCGGCGGACTGACCGGACTGGCGGCG
GCCGTCTTCCTCCGCCAGCAGGGGGTCGACTGCCTCCTGGTGGAGCGTCACCGCAGCACC
ACCTTCCTGACCCGCGCCTCCGGGATCAACGCCCGCACCATGGAACTGCTGCGCAACGCC
GGTCTGGAGGAGACGGTGATCGACCGCAGCCTCCACCTCATCGAGGGCAAGCGCTGGCGT
GAACTCGGCCAGCCCGCCGACCGGATCCCCTGGGTCGTCCTGCGCGCCCGCGACCTGGCC
GACATCGAGCGGGCGGTGATCGTCGAGGAACCCTCCCTGGACGTGGCGGACGTCAGCCCC
ACCCGAGCGCAGTGGTGCGGCCAGGACAAACTCGAACCGATCCTCCGCGACGAGGCGGTG
CGCCGTGGCGCCGACATCCGCTTCCACACCCGGCTGGATTCCTTCGCCCAGGACGCGGAC
GGGGTCGACGCGGTCATCGTGGACCGCGGCACGGGCGCCCGCACCGCCGTGCGCAGCCGG
TACCTCATCGCCGCGGACGGGGTGCGCAGCACCGTCCGGCAGGCCCTCGGCGTCACCGGC
ACCGGCCACGGCTCGCTGGGCAAGGCGATGAGCGTCCTGTTCCAGGCCGACTTCGAACCG
GTCCTGCACGGCCGGCGCTTCGTCATCACCTACATGGCCAACCCGCAGGCGCCCGGCGTC
CTGCAGACCTTCGACGAGAACCGGTGGATCTTCGGGTTCTTCTGCGACGCGTACGGCGGC
GGCGACGCCGCGTTCGACACCGGGCGCTGCGCGGACATCGTGCGGACCTCCCTCGGCATC
CCCGACATCCCCCTGGACGTCCAGCTGGTCCAGCCCTGGGAGATGTCGCACCACGTCGCC
GACAGCTACCGCAGCGGACGGGTCTTCCTCGCCGGCGACGCCGCGCACGTCCATCCGCCC
GCGGGCGCCTTCGGGGCCAACGGCGGGATCCAGGACGCGCACAACCTGGCCTGGAAACTC
GCCTCCGTCCTGCACGGCCGGGCGAGCGACGCCCTCCTCGACACCTACCACCAGGAGCGG
CACCCGGTCGGCACGGAGATCGCCGAACAGGCCTGGACGCGCCACACGTACCGGCTCGAC
GGGGACGACGAGCTGGGGCGACGCCTCGTCGACACCAAGGTCGTGGCCGCCGGCTACCGC
TACACGTCCTCGGCCGTGCTGGGAGCGGCGTACCCCACGGCGATCCCGCACGAGCTGGCG
CTCACCGGCCTCCCGGGGCAGCGCGTCCCGCACGTGTGGCTCGACCACGACGGCCGCCGC
GTCTCGACCGTCGACCTCGCCGTGGACGGATTCGTCCTGCTCGCCCGGGCCGACGGCACA
CCGTGGGCGGACGCGGCGGCCCGGCTCGCCGCGACGACCGGCATCCCGCTCACCGCCCAT
GTCGTCGGCAAGACCCTGACCGACCCCGCCGACGCGCTCGCCGCCGCCACGGGACTCGGC
GAGGCGGGCGCCCTGCTGCTGCGCCCGGACGGCTTCGTCGCCTGGCGCAGCGACACGTCC
GCCGACGACCCCGAAGCCGTACTCGACGGCGTCCTCGCCCGGATCCTGGCCCGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [5-370]  2.99999999999998e-107 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.49999648196323e-45 PR00420 [178-193]  1.49999648196323e-45 PR00420 [305-320]  1.49999648196323e-45 PR00420 [320-336]  1.49999648196323e-45 PR00420 [338-356]  1.49999648196323e-45 PR00420 [356-372]  1.49999648196323e-45 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-21]  0.432 Signal
Eukaryota   
TMHMM
 [7-24]  Transmembrane (i-o)
Transmembrane 1