close all open/close all

CDS information : Ello_00080


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction7,813 / 8,142 / + [in whole cluster]
7,813 / 8,142 / + [in contig]
Location7813..8142 [in whole cluster]
7813..8142 [in contig]
TypeCDS
Length330 bp (109 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-5 monooxygenase
Product (GenBank)TcmF1 monooxygenase
Gene
Gene (GenBank)elmH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>C-5 monooxygenase [TcmF1 monooxygenase]
MPRLSPDAAYYTLVNVFTVSPDDQEKLYRHLVDVTERTIRHLPGFVSATFHLGNNGRHVV
NYAQWESEETFRSMHALPELQEHFAFCRGIATPLSVPCAVAQVFEEAAG
selected fasta
>C-5 monooxygenase [TcmF1 monooxygenase]
ATGCCCCGACTGTCCCCCGACGCCGCGTACTACACGCTCGTCAACGTCTTCACCGTCTCG
CCCGACGACCAGGAGAAGCTCTACCGCCACCTCGTCGACGTGACCGAGCGGACCATCCGC
CACCTCCCCGGTTTCGTCTCCGCCACCTTCCACCTGGGCAACAACGGCCGGCACGTCGTC
AACTACGCCCAGTGGGAGAGCGAGGAAACGTTTCGCTCCATGCATGCGCTGCCCGAGCTC
CAGGAGCACTTCGCCTTCTGCCGCGGCATCGCCACCCCCCTGTCCGTGCCCTGCGCCGTG
GCCCAGGTCTTCGAGGAGGCCGCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [11-84]  1e-16 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-104]  6.79998707392904e-25 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit