close all open/close all

CDS information : Ello_00090


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction8,139 / 8,459 / + [in whole cluster]
8,139 / 8,459 / + [in contig]
Location8139..8459 [in whole cluster]
8139..8459 [in contig]
TypeCDS
Length321 bp (106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)TcmF2 cyclase
Gene
Gene (GenBank)elmI
EC number
Keyword
  • 4th ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q9L4X9
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
ACC
P39890
PmId
[8218177] Tetracenomycin F2 cyclase: intramolecular aldol condensation in the biosynthesis of tetracenomycin C in Streptomyces glaucescens. (Biochemistry. , 1993)

close this sectionSequence

selected fasta
>cyclase/dehydratase [TcmF2 cyclase]
MTYRALMVLRMDPADAERVAAAFEDHDTTGLPEEIGLTRRTLFRFHDLYMHLIEADDDVL
PKILEARDDPRFRKVNEEVGRYLTPYASDWSRLTDSKAEVIYTWEA
selected fasta
>cyclase/dehydratase [TcmF2 cyclase]
ATGACGTACCGGGCCCTGATGGTGCTGCGGATGGACCCGGCCGACGCCGAACGGGTGGCG
GCCGCCTTCGAGGACCACGACACCACCGGACTGCCCGAGGAGATCGGGCTCACCCGCCGC
ACCCTGTTCCGCTTCCACGACCTGTACATGCACCTCATCGAGGCCGACGACGACGTGCTG
CCGAAGATCCTCGAGGCCCGCGACGACCCGCGCTTCCGGAAGGTCAACGAGGAAGTCGGC
CGCTACCTCACCCCGTACGCGTCGGACTGGAGCCGGCTCACCGACTCCAAGGCCGAGGTC
ATCTACACCTGGGAAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [3-106]  1.09999999999999e-39 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
 [1-106]  PD012644
PD012644   Polyketide_synth_cyclase
 [11-106]  5.89999999999994e-35 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [2-106]  9.69997533354407e-39 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit