close all open/close all

CDS information : Ello_00100


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction8,471 / 8,902 / + [in whole cluster]
8,471 / 8,902 / + [in contig]
Location8471..8902 [in whole cluster]
8471..8902 [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)third ring cyclase
Gene
Gene (GenBank)elmJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P16558
PmId
[8244926] The tcmVI region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens encodes the tetracenomycin F1 monooxygenase, tetracenomycin F2 cyclase, and, most likely, a second cyclase. (J Bacteriol. , 1993)
[8248801] Enzymatic synthesis of a bacterial polyketide from acetyl and malonyl coenzyme A. (Science. , 1993)
[9609708] Reconstitution of the iterative type II polyketide synthase for tetracenomycin F2 biosynthesis. (Biochemistry. , 1998)
ACC
P23157
PmId
[15701630] A novel quinone-forming monooxygenase family involved in modification of aromatic polyketides. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [third ring cyclase]
MTAQTPPPVIGVDDVTPSTRQGGRTRALLTPTSAGATGGFLGTLDLGPGERISEHYHPYS
DKYLYAVAGSVVVEVDGHEITLGTDQALLVTRGMRHRFHNRTEAPARLVFQISPLAPRPD
LGHVDTEPVPRPQDAPPTVGGVR
selected fasta
>putative oxidoreductase [third ring cyclase]
ATGACCGCGCAGACACCCCCGCCCGTCATAGGCGTCGACGACGTCACGCCGTCGACCCGG
CAGGGCGGCCGCACCAGGGCCCTGCTCACCCCCACGTCCGCCGGAGCGACCGGCGGGTTC
CTCGGCACCCTCGACCTCGGCCCCGGCGAGCGGATCAGCGAGCACTACCACCCCTACTCC
GACAAGTACCTGTACGCCGTGGCCGGCTCCGTGGTCGTGGAGGTGGACGGCCACGAGATC
ACCCTCGGCACCGATCAGGCGCTGCTGGTCACCCGGGGCATGCGGCACCGGTTCCACAAC
CGCACCGAGGCGCCGGCCCGGCTCGTCTTCCAGATCAGCCCGCTCGCGCCCCGCCCGGAC
CTCGGACACGTCGACACCGAGCCCGTACCCCGTCCCCAGGACGCCCCGCCCACCGTCGGA
GGAGTGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [1-139]  1e-21 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [45-109]  5.40000000000002e-17 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [21-125]  2.4e-19 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
IPR016672 Polyketide biosynthesis protein CurC, predicted (Family)
 [1-141]  6.10002656149838e-81 PIRSF016602
PIRSF016602   CurC_prd
SignalP
 [1-36]  0.357 Signal
Bacteria, Gram-positive   
TMHMM No significant hit