close all open/close all

CDS information : Ello_00110


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction8,899 / 10,170 / + [in whole cluster]
8,899 / 10,170 / + [in contig]
Location8899..10170 [in whole cluster]
8899..10170 [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketoacyl synthase alpha
Gene
Gene (GenBank)elmK
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q54495
NITE
Nogl_00370
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS4..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase alpha]
MTGRQVVITGIGVRAPGGTGVKAFWDLLSSGRTATRRISSFDPSPYRSQIAAEIDFDPLG
EGFTDRQIARWDRAVLLAVAAAREALAHSGLAPGALRPETVGVSVGSAVGCTTSLDTEYA
RVSHGGADWLVDHTLAVQQLFDYFVPTSISREVAWEVGAEGPVTLVSTGCTSGLDAVGNG
ASLIRDGNADVVLAGATDAPISPITVACFDAIKATSPNNADPEHASRPFDRRRDGFVLGE
GAAMFVLEEKEAALRRGAPVLAEVAGFATRANAYHMTGLRSDGREMAAAIDAALLAAGRG
PADVDYINAHGSGTRQNDRHETAAFKRSFGERAYAIPVSSIKSMIGHSLGAIGSLELAAC
VLAMESDLIPPTANYAEPDPECDLDYVPNTAREARLDTVVSVGSGFGGFQSAAVLTRPEG
RPR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase alpha]
ATGACCGGCCGACAGGTCGTCATCACCGGCATCGGCGTCCGGGCGCCGGGCGGCACCGGC
GTCAAGGCGTTCTGGGACCTGCTGAGCTCGGGGCGCACCGCGACCCGCAGGATCAGCTCC
TTCGACCCCTCCCCGTACCGTTCGCAGATCGCCGCGGAGATCGACTTCGACCCGCTCGGC
GAGGGCTTCACCGACCGGCAGATCGCGCGCTGGGACCGCGCCGTGCTGCTGGCCGTGGCC
GCCGCCCGCGAGGCCCTCGCGCACAGCGGCCTCGCACCGGGCGCACTGCGCCCGGAGACC
GTCGGGGTCAGCGTCGGCAGCGCCGTCGGCTGCACGACCAGCCTCGACACCGAGTACGCG
CGGGTCAGCCACGGCGGGGCGGACTGGCTCGTCGACCACACCCTCGCCGTCCAGCAGCTC
TTCGACTACTTCGTGCCCACGTCCATCTCCCGCGAGGTGGCCTGGGAGGTCGGCGCCGAA
GGCCCGGTCACGCTGGTGTCCACCGGCTGCACCTCCGGCCTCGACGCCGTCGGCAACGGC
GCGTCGCTGATCCGGGACGGGAACGCCGACGTCGTGCTCGCCGGAGCCACCGACGCCCCC
ATCTCGCCCATCACGGTCGCCTGCTTCGACGCCATCAAGGCGACCTCCCCGAACAACGCC
GACCCCGAGCACGCCTCGCGCCCCTTCGACCGGCGCCGCGACGGATTCGTGCTCGGCGAG
GGAGCGGCCATGTTCGTCCTGGAGGAGAAGGAGGCCGCGCTGCGCCGGGGCGCCCCTGTC
CTCGCCGAGGTGGCCGGTTTCGCCACCCGCGCCAACGCCTACCACATGACCGGTCTGCGG
TCCGACGGACGGGAGATGGCGGCCGCGATCGACGCGGCGCTCCTGGCGGCCGGCCGAGGC
CCCGCCGACGTCGACTACATCAACGCACACGGTTCGGGGACCCGGCAGAACGACCGGCAC
GAGACCGCCGCATTCAAGCGCAGCTTCGGGGAGCGGGCGTACGCGATCCCGGTCAGCTCC
ATCAAGTCCATGATCGGTCACTCCCTCGGGGCGATCGGCTCCCTCGAACTGGCCGCCTGT
GTGCTCGCGATGGAGTCGGACCTGATCCCGCCCACCGCCAACTACGCGGAGCCGGACCCC
GAGTGCGACCTCGACTACGTGCCCAACACCGCCCGCGAGGCCCGCCTGGACACCGTGGTC
AGCGTCGGCAGCGGATTCGGCGGGTTCCAGAGCGCCGCCGTACTGACCCGGCCCGAGGGG
AGGCCCAGGTGA
KS4..375
KS10..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-253]  9.9e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-375]  4.6e-36 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [8-266]  1.29999999999998e-63 G3DSA:3.40.47.10 [271-418]  1.09999999999999e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-420]  1.59998835313644e-67 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-36]  0.156 Signal
Bacteria, Gram-positive   
TMHMM No significant hit