close all open/close all

CDS information : Ello_00120


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction10,167 / 11,402 / + [in whole cluster]
10,167 / 11,402 / + [in contig]
Location10167..11402 [in whole cluster]
10167..11402 [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)ketoacyl synthase beta
Gene
Gene (GenBank)elmL
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
ACC
Q56164
NITE
Jado_00090
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
ACC
Q54496
NITE
Nogl_00380
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

CLF13..369

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [ketoacyl synthase beta]
MTGSDTEDGSTGWITGLGVVAPNGIGAEEYWKATLEGRSGLRTITGFDAGQYPVRVAGEV
GTFADEPSLSGRILPQTDRMTRYALVASDWALADSGVRTDEHDGFSTGVITASAAGGFEF
GQRELQKLWGSGPGEVSAYQSFAWFYAVNTGQISIRHGLRGHSSVAVAEQAGGLDAVAQA
TRLVDHGTLRVAVAGGFEAPVSPWGLVAQIPSGLLSTVADPARAYLPFDPDASGWVPGEG
GAALVVERAADARARGADHVYGRIAGHASTFDPRPGLGRPPALARAVRTALDRARTHPGD
IDVVFADAAGLPEQDAAEVAALTEVFGSRKVPVTAPKTMTGRLYSGGGALDTATALLALR
DGVVPPTVGTRTAPPELDLVLGAPRDLPLRNALVLARGTGGFNSAVVVARV
selected fasta
>polyketide synthase chain length factor subunit [ketoacyl synthase beta]
GTGACCGGCTCCGACACCGAGGACGGCTCCACCGGCTGGATCACCGGCCTGGGGGTCGTG
GCGCCCAACGGCATCGGCGCGGAGGAGTACTGGAAGGCCACGCTGGAAGGCCGCAGCGGC
CTTCGCACGATCACCGGATTCGACGCCGGGCAGTACCCCGTACGGGTCGCCGGAGAGGTC
GGGACCTTCGCCGACGAACCGAGCCTGTCCGGGCGCATCCTCCCGCAGACCGACCGGATG
ACCCGGTACGCACTGGTCGCCAGCGACTGGGCCCTGGCGGACTCCGGGGTCCGCACCGAC
GAGCACGACGGGTTCTCCACCGGAGTGATCACGGCAAGTGCCGCCGGCGGCTTCGAGTTC
GGCCAACGGGAACTGCAGAAGCTGTGGGGGAGCGGGCCCGGAGAGGTGAGCGCCTACCAG
TCGTTCGCCTGGTTCTACGCCGTGAACACCGGCCAGATCTCCATCCGGCACGGCCTGCGC
GGCCACAGCTCGGTGGCGGTCGCCGAGCAGGCCGGCGGCCTCGACGCCGTGGCGCAGGCC
ACCCGGCTCGTCGACCACGGCACCCTGCGCGTCGCCGTCGCCGGCGGGTTCGAGGCGCCG
GTGTCCCCCTGGGGCCTCGTCGCCCAGATCCCCAGCGGCCTGCTGAGCACCGTGGCCGAC
CCCGCCCGCGCCTATCTGCCCTTCGACCCGGACGCCTCCGGGTGGGTGCCCGGCGAGGGC
GGCGCCGCCCTGGTCGTCGAACGGGCGGCGGACGCCCGCGCCCGCGGAGCGGACCACGTC
TACGGCCGGATCGCCGGACACGCCTCGACCTTCGACCCGCGCCCCGGCCTGGGACGCCCG
CCCGCCCTCGCCCGGGCCGTCAGGACCGCCCTCGACCGTGCCCGTACACATCCCGGCGAC
ATCGATGTCGTCTTCGCGGACGCCGCCGGGCTCCCGGAGCAGGACGCCGCCGAAGTGGCG
GCCCTCACCGAGGTGTTCGGCTCCCGGAAGGTGCCCGTCACCGCCCCGAAGACCATGACC
GGACGGCTCTACTCCGGCGGTGGCGCCCTCGACACCGCCACGGCCCTGCTCGCCCTGCGC
GACGGCGTCGTCCCGCCCACCGTGGGCACGCGCACCGCCCCGCCCGAGCTCGACCTCGTG
CTCGGCGCTCCCCGCGATCTCCCCCTGAGGAACGCCCTCGTCCTCGCCCGCGGGACCGGC
GGCTTCAACTCCGCCGTCGTCGTCGCCCGCGTCTGA
CLF13..369
CLF37..1107

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [13-252]  1.99999999999999e-51 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-369]  1.8e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [14-266]  5.30000000000001e-51 G3DSA:3.40.47.10 [279-410]  3.60000000000002e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [9-257]  3.1999989904635e-57 SSF53901 [220-411]  1.49999648196323e-48 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-27]  0.234 Signal
Bacteria, Gram-positive   
TMHMM No significant hit