close all open/close all

CDS information : Ello_00130


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction11,429 / 11,680 / + [in whole cluster]
11,429 / 11,680 / + [in contig]
Location11429..11680 [in whole cluster]
11429..11680 [in contig]
TypeCDS
Length252 bp (83 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)elmM
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P12884
PmId
[1592832] Purification and characterization of the acyl carrier protein of the Streptomyces glaucescens tetracenomycin C polyketide synthase. (J Bacteriol. , 1992)

close this sectionPKS/NRPS Module

ACP3..76

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MLTLDALVAVIRRCAGDSDVTSLDGDILDTPYQDLGYDSLALLEIFASLERDYAVPISDE
EVFETRTPRQTLDLINDRIKAAR
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGCTCACCCTGGACGCACTCGTCGCCGTCATCCGCCGCTGCGCCGGCGACTCCGACGTC
ACCTCCCTGGACGGCGACATCCTCGACACCCCCTACCAGGACCTCGGGTACGACTCGCTG
GCGCTGCTGGAGATCTTCGCCTCCCTGGAGCGGGACTACGCCGTCCCGATCAGCGACGAG
GAGGTCTTCGAGACGAGGACGCCGCGCCAGACCCTCGACCTGATCAACGACCGGATCAAG
GCGGCCCGATGA
ACP3..76
ACP7..228

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [3-80]  6.40000000000001e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [3-76]  PS50075
PS50075   ACP_DOMAIN
 [23-75]  2.2e-09 PF00550
PF00550   PP-binding
 [4-82]  1.49999977583352e-11 SSF47336
SSF47336   ACP_like
SignalP
 [1-16]  0.418 Signal
Eukaryota   
TMHMM No significant hit