close all open/close all

CDS information : Ello_00140


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction11,677 / 12,135 / + [in whole cluster]
11,677 / 12,135 / + [in contig]
Location11677..12135 [in whole cluster]
11677..12135 [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)elmNI
EC number
Keyword
  • 1st and 2nd ring
  • unreduced polyketide
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
[8692863] Deciphering the mechanism for the assembly of aromatic polyketides by a bacterial polyketide synthase. (Proc Natl Acad Sci U S A. , 1996)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[18388203] Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MTTTDNTITIRAPFDLVWRRTNDVESWPTLFAEYASVDVLRRDGDAVEFRLTTRPDADGK
VWSWVSRREPDLASRTVSARRVETGPFRFMHLTWTYQETPDGVVLRWIQEFEVADEAPFD
DAAMAERIDRNTRLNMGRIKQLIEADATKETV
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGACCACCACCGACAACACGATCACCATCCGCGCGCCCTTCGACCTGGTGTGGCGCAGG
ACCAACGACGTCGAGTCCTGGCCGACCCTGTTCGCCGAGTACGCCTCCGTCGACGTGCTC
CGGCGGGACGGCGACGCCGTCGAGTTCCGCCTCACCACCCGGCCCGACGCCGACGGAAAG
GTGTGGTCGTGGGTCTCCCGCCGGGAGCCAGACCTGGCCTCCCGCACCGTCAGCGCCCGG
CGCGTCGAAACCGGTCCGTTCCGCTTCATGCACCTCACCTGGACCTACCAGGAGACGCCG
GACGGCGTCGTCCTGCGCTGGATCCAGGAGTTCGAGGTCGCGGACGAGGCGCCGTTCGAC
GACGCCGCCATGGCCGAACGGATCGACCGCAACACGCGCCTCAACATGGGCCGGATCAAG
CAGCTGATCGAAGCGGACGCCACGAAGGAGACGGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [1-144]  5.10000000000001e-13 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [1-137]  2.3e-13 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit