close all open/close all

CDS information : Ello_00150


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction12,132 / 13,181 / + [in whole cluster]
12,132 / 13,181 / + [in contig]
Location12132..13181 [in whole cluster]
12132..13181 [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative C-3 O-methyltransferase
Product (GenBank)C3 O-methyltransferase
Gene
Gene (GenBank)elmNII
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
ACC
Q7X2G8
NITE
Gilvo_00100
PmId
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>putative C-3 O-methyltransferase [C3 O-methyltransferase]
MSTAYGERSAAAGLPTDLHAQRLLLLAGAGRLSRVVHVLVELGIAERIGDETRTVDELAA
DTGTDALSLYRILRVAASVGIFQEGPAKAFSATPLSDGLRPGHPGSVLPLVQYNNLDLTR
RPFEQILHSVRTGAPAFDEVFGRPFYAYLESHPEAGEFFERFMLHWSRRLVAEELPKLGL
ERFRRIVDLGGGDGGFLAEVLRRQPGTTGVLMDLPRVAASARARLAEAGLADRVTVVPDD
FFRAPIPTDGDAYLLKGVLHNWSDDKVRELLHRLRAAIGPREATLLVFDVVMSPDNRWDH
GKFLDADMLVLFGGRERTLPEWRKLFAETGFELTNEPEYRWAMLECRPV
selected fasta
>putative C-3 O-methyltransferase [C3 O-methyltransferase]
ATGAGCACCGCGTACGGCGAACGGTCCGCGGCGGCCGGACTGCCCACGGACCTGCACGCC
CAGCGTCTGCTGCTGCTCGCCGGCGCCGGCCGGCTCTCCCGGGTCGTCCACGTCCTGGTG
GAGCTGGGCATCGCCGAGCGCATCGGGGACGAGACCCGCACCGTCGACGAACTCGCCGCC
GACACCGGCACGGACGCCCTGTCCCTGTACCGGATCCTGCGCGTCGCCGCGTCCGTCGGC
ATCTTCCAGGAGGGCCCGGCCAAGGCGTTCTCGGCCACGCCGCTCTCCGACGGGCTGCGC
CCCGGGCACCCGGGCAGCGTGCTGCCCCTGGTCCAGTACAACAACTTGGACCTGACCCGG
CGCCCCTTCGAGCAGATCCTGCACAGCGTCCGCACCGGCGCACCCGCCTTCGACGAGGTG
TTCGGCCGACCGTTCTACGCCTACCTGGAGAGCCACCCCGAAGCCGGCGAGTTCTTCGAG
CGGTTCATGCTGCACTGGAGCCGCCGGCTGGTCGCCGAAGAGCTCCCGAAGCTCGGCCTC
GAACGCTTCCGCCGGATCGTCGACCTCGGCGGCGGCGACGGCGGCTTCCTCGCCGAGGTC
CTGCGCCGGCAGCCCGGGACCACGGGCGTCCTGATGGACCTGCCGAGGGTCGCCGCCTCG
GCACGCGCCCGGCTCGCCGAAGCCGGCCTCGCCGACCGGGTCACCGTCGTGCCGGACGAC
TTCTTCCGGGCGCCGATCCCCACCGACGGCGACGCGTACCTCCTCAAGGGCGTGCTGCAC
AACTGGTCCGACGACAAGGTGCGGGAACTCCTGCACCGCCTGCGGGCCGCCATCGGACCG
CGCGAGGCGACCCTGCTCGTCTTCGACGTCGTGATGTCGCCGGACAACCGCTGGGACCAC
GGCAAGTTCCTCGACGCCGACATGCTCGTCCTCTTCGGCGGCAGGGAGCGCACGCTCCCC
GAGTGGCGGAAGCTGTTCGCGGAGACCGGCTTCGAGCTGACCAACGAGCCCGAGTACCGC
TGGGCGATGCTCGAATGCAGGCCGGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [89-326]  1.6e-61 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [18-97]  3.60000000000001e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-348]  6.5999985252641e-13 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-38]  0.092 Signal
Bacteria, Gram-negative   
TMHMM No significant hit