close all open/close all

CDS information : Ello_00160


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction13,178 / 14,008 / + [in whole cluster]
13,178 / 14,008 / + [in contig]
Location13178..14008 [in whole cluster]
13178..14008 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative C-9 carboxyl O-methyltransferase
Product (GenBank)carboxyl O-methyltransferase
Gene
Gene (GenBank)elmP
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P39887
PmId
[8509339] Nucleotide sequences and heterologous expression of tcmG and tcmP, biosynthetic genes for tetracenomycin C in Streptomyces glaucescens. (J Bacteriol. , 1993)

close this sectionSequence

selected fasta
>putative C-9 carboxyl O-methyltransferase [carboxyl O-methyltransferase]
MSPDPARVAAVRLTGVQETLLAPLYVRALDNRAPRPVLGDRMAEPLMRRLDYDFRKMRFA
GRDRRTVPFRARKLDEWTAAFLGAHPDAVVVHLACGLDTRAQRLDVPRTALWFDVDLPDV
TALRRELFEESDGYRMLAGSVVETDWLGEVPRDRPALVVAEGLAPYLAEDDGLTMLRNLT
AHLSGGEILFDAVLPWTRHIARYARLIRQTGASFGWAVADPRDLERQVPGLRALDEWALC
DSPYADRLPPRDRLVLGAMRAVRPLRYAYRLLRYRF
selected fasta
>putative C-9 carboxyl O-methyltransferase [carboxyl O-methyltransferase]
ATGAGCCCGGACCCGGCGCGCGTCGCCGCCGTCCGGCTGACCGGAGTGCAGGAGACCCTG
CTCGCCCCCCTGTACGTCCGTGCCCTCGACAACCGCGCACCGCGCCCCGTGCTCGGCGAC
CGCATGGCCGAACCGCTGATGCGCCGCCTGGACTACGACTTCCGGAAGATGCGCTTCGCC
GGTCGCGACCGGCGCACGGTCCCCTTCCGGGCCCGCAAGCTCGACGAGTGGACGGCCGCC
TTCCTCGGCGCCCACCCGGACGCCGTGGTCGTGCACCTGGCGTGCGGCCTCGACACCCGG
GCCCAGCGGCTCGACGTACCGCGCACCGCGCTCTGGTTCGACGTCGACCTGCCCGACGTG
ACGGCACTGCGCCGGGAGCTGTTCGAGGAGTCCGACGGCTACCGGATGCTCGCCGGCTCC
GTGGTCGAGACGGACTGGCTGGGCGAGGTGCCGCGCGACCGGCCGGCACTGGTGGTCGCC
GAGGGGCTCGCCCCGTACCTCGCCGAGGACGACGGCCTCACCATGCTGCGCAACCTCACG
GCCCATCTGTCGGGCGGCGAGATCCTCTTCGACGCCGTGCTGCCCTGGACCCGTCACATC
GCCCGGTACGCGCGCCTCATCCGGCAGACCGGCGCGTCCTTCGGCTGGGCGGTCGCCGAC
CCCCGAGACCTGGAGCGGCAGGTCCCCGGTCTGCGGGCGCTCGACGAGTGGGCCCTGTGC
GACTCGCCGTACGCCGACCGGCTCCCGCCGCGCGACCGGCTGGTCCTGGGCGCCATGCGC
GCGGTGCGGCCCCTGCGCTACGCCTACCGGCTGCTGCGCTACCGATTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007213 Leucine carboxyl methyltransferase (Family)
 [21-179]  6.19999999999994e-40 PF04072
PF04072   LCM
IPR016874 Polyketide synthesis O-methyltransferase, TcmP (Family)
 [1-276]  3.99998544139379e-99 PIRSF028177
PIRSF028177   Polyketide_synth_Omtfrase_TcmP
SignalP
 [1-28]  0.153 Signal
Bacteria, Gram-positive   
 [1-28]  0.212 Signal
Bacteria, Gram-negative   
 [1-28]  0.259 Signal
Eukaryota   
TMHMM No significant hit