close all open/close all

CDS information : Ello_00170


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction14,028 / 15,164 / + [in whole cluster]
14,028 / 15,164 / + [in contig]
Location14028..15164 [in whole cluster]
14028..15164 [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhamnose C-2' O-methyltransferase
Product (GenBank)rhamnose C2'-methyltransferase
Gene
Gene (GenBank)elmMI
EC number2.1.1.-
Keyword
  • tri-O-methylrhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>L-rhamnose C-2' O-methyltransferase [rhamnose C2'-methyltransferase]
MDSPQVARTLVDSAGGTAAHTREAIRQIGVPETAAFLADELAGRTETVTIRHAAEVQFVF
DDRYAPDAADPVPWTFRVGPEGVTHRAGALPDPGAVVTQDLTELARSLYGPAADRSDATR
TVWWRDHDDPRVYFDPPPVFPAVERLLAAADGRDVPGLAGLALRHGSDKWGIHTYTAAYE
QHFAPFRDRAVTVVEIGVGGYDDPAAGGGSLRMWKRYFRRGLVYGVDIADKSRHREPRVH
TVVADQSDPASLRDLADAIGPIDIVIDDGSHISAHVVTAFSTLFPRLNPGGLYVVEDLQT
SYWPAFQGAYDDDTRTSVGFLKRLVDGLHHAEYPSRAGRPAQPTDRTVGSLHFHPNLAFV
EKRANSGHGGISRLREAT
selected fasta
>L-rhamnose C-2' O-methyltransferase [rhamnose C2'-methyltransferase]
ATGGACTCCCCACAGGTGGCACGGACCCTCGTCGACAGCGCGGGAGGCACCGCGGCGCAC
ACCCGTGAGGCCATCCGACAGATCGGCGTCCCGGAGACCGCCGCGTTCCTCGCCGACGAA
CTCGCCGGGCGCACGGAGACCGTGACGATCCGTCACGCGGCCGAGGTCCAGTTCGTGTTC
GACGACCGGTACGCGCCGGACGCGGCCGACCCGGTCCCCTGGACGTTCCGGGTCGGCCCG
GAGGGCGTCACCCACCGGGCCGGCGCGCTTCCGGACCCCGGGGCCGTGGTGACCCAGGAC
CTGACCGAACTGGCGCGCTCCCTGTACGGTCCGGCCGCCGACCGCTCCGACGCCACCCGC
ACGGTGTGGTGGCGCGACCACGACGATCCCCGCGTCTACTTCGACCCGCCCCCCGTGTTC
CCCGCCGTCGAACGCCTGCTGGCCGCCGCCGACGGACGGGACGTCCCCGGCCTGGCCGGA
CTCGCCCTGCGCCACGGCTCGGACAAGTGGGGGATCCACACGTACACGGCCGCCTACGAG
CAGCACTTCGCGCCGTTCCGGGACCGTGCCGTCACCGTCGTCGAGATCGGCGTCGGCGGA
TACGACGACCCCGCGGCGGGCGGCGGCTCCCTGCGCATGTGGAAGCGCTACTTCCGGCGC
GGGCTCGTCTACGGCGTGGACATCGCGGACAAGAGCAGGCACCGCGAGCCACGGGTGCAC
ACCGTCGTCGCGGACCAGTCCGACCCCGCCTCCCTGCGCGACCTGGCCGACGCGATCGGC
CCCATCGACATCGTCATCGACGACGGCAGCCACATCAGCGCCCATGTGGTGACCGCCTTC
TCCACCCTGTTCCCCCGGCTCAACCCCGGCGGGCTGTACGTGGTCGAGGACCTGCAGACC
TCGTACTGGCCGGCCTTCCAGGGCGCGTACGACGACGACACCCGCACCAGCGTCGGCTTC
CTCAAGCGGCTCGTCGACGGCCTGCACCACGCCGAGTACCCGTCCCGGGCCGGGCGCCCC
GCCCAGCCGACCGACCGAACCGTCGGCAGCCTGCACTTCCACCCCAACCTGGCCTTCGTG
GAGAAACGTGCCAACAGCGGCCACGGCGGCATCAGCCGGCTGCGGGAAGCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit