close all open/close all

CDS information : Ello_00180


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction15,166 / 16,314 / + [in whole cluster]
15,166 / 16,314 / + [in contig]
Location15166..16314 [in whole cluster]
15166..16314 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)elmGT
EC number
Keyword
  • L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[11306350] Identification of a sugar flexible glycosyltransferase from Streptomyces olivaceus, the producer of the antitumor polyketide elloramycin. (Chem Biol. , 2001)
[12444703] Digitoxosyltetracenomycin C and glucosyltetracenomycin C, two novel elloramycin analogues obtained by exploring the sugar donor substrate specificity of glycosyltransferase ElmGT. (J Nat Prod. , 2002)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
[19233921] Modulation of deoxysugar transfer by the elloramycin glycosyltransferase ElmGT through site-directed mutagenesis. (J Bacteriol. , 2009)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRVLAVATPALGHLFPAVPLLWALRARGDEVLVVTGGDALRVAEAGLPVVDALPGETLTT
LFGAYQETDPAFFVALRRSPMTTLRDLAPVLAYLAGRLLEPARRAAERWRPDAILATHGQ
AAGAVVAAEHGIPLVEHGFGFVRSDGAQEAVRQLLAERLGPAGSEPPPERYFLDIAVPSM
TSAIEGMSLRAVPYNGGAVLPLSGASVGGRPPRPRVLVTAGTQLLHTHGAGALAWLPEVA
AGHEAEFLLAAGGADLRDLGRLPPHVRVLDWTPLATVLPTCSAVVHHGGSGTTLAALAAG
VPQLVSPALADNHINARAVADRGAGLETAVPDATTLTALLREPAFAKAAREVADELRSLP
APADVAARLHTAFGLPTTQGDA
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCGTCCTGGCCGTCGCCACCCCCGCCCTGGGGCACCTCTTCCCGGCCGTGCCCCTG
CTGTGGGCGCTGCGGGCGCGAGGAGACGAGGTGCTCGTCGTCACCGGCGGCGACGCCCTG
CGCGTCGCCGAGGCCGGGCTGCCGGTCGTCGACGCGCTGCCCGGCGAGACCCTGACCACC
CTGTTCGGCGCCTACCAGGAGACGGACCCCGCCTTCTTCGTGGCGCTGCGCCGCTCGCCG
ATGACGACCCTGCGCGACCTGGCGCCCGTCCTCGCGTACCTCGCCGGCCGGCTCCTGGAA
CCGGCGCGCCGGGCCGCCGAGCGCTGGCGGCCCGATGCCATCCTGGCCACGCACGGGCAG
GCGGCCGGAGCGGTCGTCGCGGCGGAGCACGGCATCCCGCTCGTCGAGCACGGCTTCGGC
TTCGTACGGAGCGACGGCGCCCAGGAGGCCGTACGGCAGCTGCTCGCCGAACGGCTCGGC
CCCGCGGGCAGCGAGCCTCCGCCGGAGCGGTACTTCCTCGACATCGCCGTACCCAGCATG
ACGAGCGCGATCGAGGGGATGAGCCTGCGGGCCGTGCCGTACAACGGGGGAGCGGTGCTG
CCCCTCTCTGGGGCGTCCGTGGGGGGCCGGCCCCCGCGGCCCCGCGTCCTGGTGACGGCG
GGCACCCAGCTCCTGCACACCCACGGGGCCGGGGCCCTCGCCTGGCTGCCCGAGGTCGCG
GCGGGCCACGAAGCGGAGTTCCTGCTGGCCGCGGGCGGCGCCGACCTCCGCGACCTGGGA
CGGCTGCCGCCCCACGTGCGGGTCCTGGACTGGACACCGCTGGCCACGGTGCTCCCCACC
TGCTCGGCCGTCGTCCACCACGGGGGCTCCGGCACGACCCTGGCGGCCCTCGCGGCGGGC
GTCCCCCAGCTCGTGTCGCCGGCCCTGGCCGACAACCACATCAACGCCCGTGCCGTGGCG
GACCGCGGGGCCGGCCTCGAGACCGCCGTTCCCGACGCCACGACGCTGACCGCGCTGCTG
CGCGAACCGGCGTTCGCCAAAGCCGCCCGTGAGGTCGCCGACGAGCTCCGCTCCCTGCCC
GCGCCCGCCGACGTGGCCGCCCGTCTGCACACCGCGTTCGGCCTCCCGACCACTCAAGGA
GACGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [7-135]  9.5e-10 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [178-267]  1.69999999999999e-19 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.992 Signal
Eukaryota   
 [1-28]  0.401 Signal
Bacteria, Gram-positive   
 [1-28]  0.403 Signal
Bacteria, Gram-negative   
TMHMM No significant hit