close all open/close all

CDS information : Ello_00190


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction16,311 / 17,483 / + [in whole cluster]
16,311 / 17,483 / + [in contig]
Location16311..17483 [in whole cluster]
16311..17483 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhamnose C-3' O-methyltransferase
Product (GenBank)rhamnose C3'-methyltransferase
Gene
Gene (GenBank)elmMII
EC number2.1.1.-
Keyword
  • tri-O-methylrhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)

close this sectionSequence

selected fasta
>L-rhamnose C-3' O-methyltransferase [rhamnose C3'-methyltransferase]
MTTPSPTPPLAAAEVAAAAGLQQRDLLAVLDRVGLEPAVAFLVHDLTARCDTPDNPDAAR
IGLAVEHSGHRTERVLAVRKGEPVRVDEETAGPPPVRLTFDLADLVRGVYGPPPGPGAGL
FRVERDDAWFVKNADDAEPFRIFESYMRAVDVLVRAATSRPGDLGRLAARHASDKWGLWH
WFTPLYEHHFARLRHQPVRVLELGIGGYQNPDEGGGSLKMWRSYFPQGRIFGVDYFPKHG
LDEDRIHTLQGSQDDAGFLRRVAEEHGPFDIVIDDGSHVAGHQQTAFRTLFPAVRNGGFY
VIEDLWTAYCPGYGGAATARAEGRTSIGLLKSLLDDLHYEEWTAPEPAAPGFAAPSLVGV
HVYRNLAVLEKGRNSEGTIPFFAPREIDYV
selected fasta
>L-rhamnose C-3' O-methyltransferase [rhamnose C3'-methyltransferase]
ATGACCACCCCTTCACCCACGCCACCGCTCGCGGCCGCCGAGGTGGCCGCCGCCGCGGGA
CTCCAGCAGCGGGACCTGCTCGCGGTGCTCGACCGGGTCGGCCTGGAACCCGCCGTCGCG
TTCCTCGTCCATGACCTCACGGCCCGCTGCGACACCCCCGACAACCCGGACGCGGCCCGG
ATCGGCCTCGCCGTCGAGCACAGCGGACACCGGACCGAGCGGGTCCTCGCCGTGCGCAAG
GGCGAGCCCGTCCGGGTGGACGAGGAGACGGCCGGTCCGCCTCCCGTACGTCTGACCTTC
GACCTCGCCGACCTGGTCCGTGGCGTGTACGGACCGCCGCCCGGTCCCGGAGCCGGTCTG
TTCCGGGTCGAACGCGACGACGCCTGGTTCGTCAAGAACGCCGACGACGCCGAGCCCTTC
CGGATCTTCGAGTCGTACATGCGCGCCGTCGACGTCCTCGTCCGCGCCGCCACGTCCCGG
CCCGGCGACCTGGGGCGGCTCGCGGCGCGCCACGCCTCCGACAAGTGGGGCCTGTGGCAC
TGGTTCACGCCCCTGTACGAACACCACTTCGCCCGGCTGCGCCACCAGCCGGTCCGGGTC
CTCGAACTCGGCATCGGCGGCTACCAGAACCCGGACGAGGGCGGCGGCTCGCTGAAGATG
TGGCGGTCCTACTTCCCGCAGGGCCGGATCTTCGGCGTCGACTACTTCCCGAAGCACGGC
CTGGACGAGGACCGCATCCACACCCTCCAGGGCAGCCAGGACGACGCCGGATTCCTGCGC
CGGGTCGCCGAGGAGCACGGGCCGTTCGACATCGTGATCGACGACGGCAGCCATGTGGCC
GGGCACCAGCAGACGGCGTTCCGCACGCTCTTCCCGGCGGTCCGCAACGGGGGCTTCTAC
GTCATCGAGGACCTGTGGACGGCGTACTGCCCCGGCTACGGGGGTGCCGCGACCGCACGC
GCGGAGGGCCGGACCTCCATCGGACTGCTCAAGTCCCTGCTGGACGACCTGCATTACGAG
GAGTGGACCGCGCCGGAGCCGGCCGCCCCCGGATTCGCCGCCCCGTCCCTGGTCGGCGTC
CACGTCTACCGCAACCTCGCGGTCCTGGAGAAGGGCCGCAACAGCGAGGGAACGATCCCG
TTCTTCGCGCCCCGAGAGATCGACTACGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit