close all open/close all

CDS information : Ello_00210


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction18,668 / 19,450 / + [in whole cluster]
18,668 / 19,450 / + [in contig]
Location18668..19450 [in whole cluster]
18668..19450 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF4

close this sectionSequence

selected fasta
>[dehydrogenase]
MTDVLARSTDLTGRVALITGAARGQGAQHARTLAAAGASVILTDLDEKGAEAVCAEIRAA
SGRPDAALAARHDVASAADWERVVALATDRHGRLDVLVNNAALWRTAPVGEQDEEEFRTL
LSVNLVGPFLGIRAVLPAMRAAGGGSIVNISSTAGLKGIPGHSAYGASKFGLRGLTKSAA
LDVAADGIRVNSVHPGVIDTPMIGAVTGGEDATAREWPHVPARRIGTVDDVAGLVLFLAS
DASAYVTGAEFAVDGGLGAQ
selected fasta
>[dehydrogenase]
ATGACCGACGTATTGGCCCGTTCCACCGATCTGACGGGGCGGGTGGCCCTGATCACGGGA
GCCGCACGCGGGCAGGGCGCGCAGCACGCCCGGACGCTGGCCGCCGCCGGGGCTTCCGTG
ATCCTGACCGACCTGGACGAGAAGGGCGCGGAGGCCGTATGCGCGGAGATCCGCGCGGCC
TCCGGGCGCCCGGACGCCGCCCTGGCCGCCCGCCACGACGTCGCGAGCGCCGCCGACTGG
GAGCGTGTCGTCGCGCTGGCCACCGATCGCCACGGACGGCTCGACGTGCTGGTCAACAAT
GCCGCGCTGTGGCGCACGGCGCCGGTGGGGGAGCAGGACGAGGAGGAGTTCAGGACGCTG
CTCTCCGTCAACCTCGTGGGGCCCTTCCTCGGCATCCGGGCCGTACTGCCCGCCATGCGC
GCGGCGGGCGGCGGCTCGATCGTCAACATCTCGTCCACCGCGGGACTCAAGGGCATACCC
GGGCACAGCGCGTACGGGGCGTCCAAGTTCGGGCTGCGCGGGCTCACCAAATCGGCCGCC
CTGGACGTCGCCGCCGACGGCATCCGGGTCAACAGCGTGCACCCCGGCGTGATCGACACC
CCGATGATCGGCGCGGTGACCGGGGGCGAGGACGCCACCGCCCGAGAGTGGCCGCACGTT
CCCGCGCGGCGCATCGGGACGGTCGACGACGTCGCGGGCCTCGTCCTCTTCCTCGCCTCG
GACGCCTCCGCGTACGTCACGGGCGCGGAGTTCGCCGTCGACGGCGGGCTGGGGGCGCAG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [92-103]  7.30000590915208e-12 PR00080 [145-153]  7.30000590915208e-12 PR00080 [165-184]  7.30000590915208e-12 PR00080
PR00080   SDRFAMILY
 [15-182]  4.40000000000001e-32 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [15-32]  9.30000048475975e-43 PR00081 [92-103]  9.30000048475975e-43 PR00081 [139-155]  9.30000048475975e-43 PR00081 [165-184]  9.30000048475975e-43 PR00081 [186-203]  9.30000048475975e-43 PR00081 [221-241]  9.30000048475975e-43 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [7-257]  1.20000000000001e-86 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [152-180]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-30]  0.218 Signal
Bacteria, Gram-negative   
TMHMM No significant hit