close all open/close all

CDS information : Ello_00220


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction19,447 / 20,376 / + [in whole cluster]
19,447 / 20,376 / + [in contig]
Location19447..20376 [in whole cluster]
19447..20376 [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)lipase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF5

close this sectionSequence

selected fasta
>[lipase]
MTGDRLSAAARGIVDMLSAGFPAALGPDTDVAALRQSILQQPSGLPELASVTDRTVPGPE
GAPDVPVRIYQPGARGAALPVVVFFHGGGFVLCGLDSHDGLCRELAASSGAVVVSVDYRL
APEHPAPAAVEDAYAALAWVAAHAEELGADPARLAVAGDSAGGNLAAAVCLLARERGGPV
PAAQVLIYPALDPAQDSASMREFGEGHFLTADQMRWYWEQYLAGSEPTPLTAPATAHDLS
GLPPALLVEAECDPLRDEGRAYAARLPEADVHSAPGVFHGFLDFTAELPQAVAAQRRVAE
WLRERLGAS
selected fasta
>[lipase]
GTGACCGGCGACCGGCTGAGCGCCGCGGCGCGCGGCATCGTGGACATGCTCTCCGCCGGC
TTCCCGGCGGCGCTCGGGCCCGACACGGACGTGGCCGCCCTGCGCCAGAGCATCCTCCAA
CAGCCTTCCGGGCTGCCCGAGCTCGCGTCGGTGACCGACCGGACGGTCCCCGGCCCCGAA
GGAGCGCCCGACGTGCCCGTACGGATCTACCAGCCGGGGGCGCGCGGAGCGGCGCTGCCG
GTGGTCGTGTTCTTCCACGGCGGCGGTTTCGTGCTGTGCGGTCTCGACAGCCACGACGGG
CTCTGCCGTGAACTGGCCGCGAGCAGCGGCGCCGTCGTCGTCTCCGTCGACTACCGCCTG
GCCCCCGAGCACCCGGCCCCGGCCGCCGTCGAGGACGCCTATGCCGCACTGGCCTGGGTG
GCGGCGCACGCGGAGGAACTCGGCGCCGATCCGGCCCGCCTCGCCGTCGCCGGAGACAGC
GCCGGAGGCAACCTCGCGGCCGCCGTCTGCCTGCTGGCCAGAGAGCGGGGCGGACCCGTG
CCCGCCGCGCAGGTGCTGATCTACCCGGCGCTCGACCCGGCTCAGGACAGCGCGTCGATG
CGGGAGTTCGGCGAAGGCCACTTCCTCACCGCCGACCAGATGAGGTGGTACTGGGAGCAG
TACCTGGCCGGCTCCGAGCCGACTCCCCTCACCGCGCCCGCGACCGCGCACGACCTGTCG
GGGCTGCCCCCGGCGCTTCTCGTCGAGGCCGAGTGCGATCCGCTGCGCGACGAGGGACGC
GCCTACGCGGCCCGGCTGCCCGAGGCCGACGTGCACTCGGCACCCGGCGTGTTCCACGGC
TTCCTCGACTTCACCGCCGAGCTGCCCCAGGCGGTGGCGGCGCAGCGGCGGGTGGCCGAG
TGGCTGCGTGAGCGGCTGGGAGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002168 Lipase, GDXG, active site (Active_site)
 [154-166]  PS01174
PS01174   LIPASE_GDXG_SER
IPR013094 Alpha/beta hydrolase fold-3 (Domain)
 [82-282]  1.10000000000001e-75 PF07859
PF07859   Abhydrolase_3
SignalP No significant hit
TMHMM No significant hit