close all open/close all

CDS information : Ello_00230


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction21,655 / 20,417 / - [in whole cluster]
21,655 / 20,417 / - [in contig]
Locationcomplement(20417..21655) [in whole cluster]
complement(20417..21655) [in contig]
TypeCDS
Length1,239 bp (412 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)solute binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF6

close this sectionSequence

selected fasta
>[solute binding protein]
MAAVGLLGSLVTGCGSAGSDGTTLRLVVPEYGDSPATSSKAYWDELTAAFGAAHPGKKVE
VTLYPWADIDQEVTRMVKEGDAPDVALMGAYSDFAAQGLLYPAEEILSIRAEANFLPPLA
EAGSVDHTLYGLPFVASSRLLFCNEELFDKAGAKPPKTWSDLKDAAQALKEEGVLYPYAL
PLGPEEAHAEALIWELSNGGGYTDSSGAYSIASDKNTQTFRWIKKNLVGEGLTGPVPPGS
LNRQDAFAAFLRGDVGMVNGYPSLLHEARAKGMRVGTLTMPVSDTLGDGQTPPSAGVADW
MMAFRHEGNRELVGSFLDFVYEDKNLSEFAGRYHLLPSTVTASQASQDAATDPSAEQFLT
ALRTAQLYPVDDPSWLQVSNTIKRNIGKAVAPTADPKTVLEDIARQARTAEQ
selected fasta
>[solute binding protein]
GTGGCCGCGGTCGGGCTACTGGGCTCCCTCGTCACCGGCTGCGGCTCGGCGGGGAGCGAC
GGGACGACGCTGCGTCTTGTGGTCCCCGAGTACGGCGACAGCCCGGCGACCAGCTCCAAG
GCGTACTGGGACGAGCTGACCGCCGCTTTCGGTGCCGCGCACCCCGGCAAGAAGGTCGAG
GTGACGCTCTACCCGTGGGCCGACATCGACCAGGAGGTCACGCGCATGGTCAAGGAAGGC
GATGCCCCCGACGTCGCCTTGATGGGCGCCTACTCCGACTTCGCCGCCCAGGGCCTGCTC
TACCCGGCGGAGGAGATCCTGTCGATCAGGGCCGAGGCGAATTTCCTGCCGCCGCTCGCG
GAAGCCGGTTCGGTCGACCACACGCTCTACGGCCTGCCCTTCGTCGCCAGCAGCCGGCTG
CTCTTCTGCAACGAGGAACTCTTCGACAAGGCCGGAGCGAAGCCGCCGAAGACCTGGTCG
GACCTGAAGGACGCCGCGCAGGCGCTGAAGGAGGAGGGCGTGCTCTACCCGTACGCCCTC
CCCCTCGGCCCCGAGGAGGCGCACGCCGAGGCCCTGATCTGGGAGCTGAGCAACGGCGGC
GGCTACACCGACAGCAGCGGCGCCTACAGCATCGCGTCGGACAAGAACACCCAGACGTTC
CGCTGGATCAAGAAGAACCTGGTCGGCGAGGGCCTGACCGGCCCGGTCCCGCCGGGCAGC
CTCAACCGGCAGGACGCCTTCGCCGCGTTCCTGCGCGGCGACGTCGGCATGGTCAACGGC
TACCCCTCGCTCCTGCACGAGGCGAGAGCGAAGGGCATGAGGGTCGGCACCCTGACCATG
CCGGTGTCGGACACGCTGGGCGACGGGCAGACCCCGCCGTCGGCGGGCGTCGCCGACTGG
ATGATGGCCTTCAGGCACGAGGGGAACCGGGAACTGGTCGGCTCCTTCCTGGACTTCGTG
TACGAGGACAAGAACCTCAGCGAGTTCGCCGGGCGTTACCACCTGCTGCCGTCGACGGTG
ACCGCGAGCCAGGCCTCCCAGGACGCCGCCACGGACCCCAGTGCCGAGCAGTTCCTGACC
GCCCTGCGGACGGCGCAGCTCTACCCGGTGGACGACCCCTCCTGGCTGCAGGTCAGCAAC
ACCATCAAGCGGAACATCGGCAAGGCCGTCGCCCCGACCGCCGACCCGAAGACCGTCCTG
GAGGACATCGCTCGACAGGCCCGGACCGCGGAACAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-19]  0.877 Signal
Bacteria, Gram-negative   
 [1-17]  0.995 Signal
Eukaryota   
TMHMM No significant hit