close all open/close all

CDS information : Ello_00240


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction23,718 / 21,952 / - [in whole cluster]
23,718 / 21,952 / - [in contig]
Locationcomplement(21952..23718) [in whole cluster]
complement(21952..23718) [in contig]
TypeCDS
Length1,767 bp (588 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)VanW-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF7

close this sectionSequence

selected fasta
>[VanW-like protein]
MRRSTTDHATADPSGRRGHIRKAALATGAVAAVAGGLYVAGLVATGDDISAGTRVDGVDI
GGLSRAEAAARLTNAAPAAWKDPLKVRIGDTDATVDPAAAGLTVDVAATADKAADPSRDP
FTVIGRLFSSGERDIEPVVSFDAGKARAAVAETAKEHDRTVREGAVAFTNGKAVATQPRE
GRALDTAAAVDALRGAYPAPGGAAPVALPVSVTQPRVTAAEVSRFMKDFATPAMSGPVTL
TAGDKRLAISAATLSDHLKVTSAGGRLSSSLDTASLLRDPDVARPLDALTGAPVEARLGV
QDGKVVVEEDGRPGREVSATALGRAVEPLLTKEGAAARTAPVPTKVTQPQLTAASLAALG
IKEQMSTFTVNFPTAPYRTTNIGRAVELINGSVVQPGEVWSFNRTVGERTKANGFVDGTM
IMDGQYQKAPGGGVSAVATTVYNALFFAGVKPLEHGAHSFYIERYPAGREATVAWGTLDL
RFRNDSGNPIYIKASSTDSSVTVSFLGTKKYDSVEAVAGPRTNVTPPAEREDPSPKCEVQ
EPLEGFDIKVDRVFKNGGTEVKRETFSTHYTPRDKVTCVGTGDAPKKP
selected fasta
>[VanW-like protein]
GTGCGCCGCTCCACGACCGACCACGCCACCGCGGACCCTTCGGGGCGCCGCGGCCACATA
CGCAAGGCGGCGCTCGCGACCGGCGCGGTCGCGGCCGTCGCCGGAGGGCTCTATGTGGCC
GGCCTCGTCGCCACCGGGGACGACATATCCGCCGGCACCCGCGTCGACGGGGTCGACATC
GGCGGGCTGAGCCGCGCCGAGGCCGCCGCCCGCCTGACGAACGCGGCCCCCGCCGCCTGG
AAGGACCCGCTGAAGGTCCGTATCGGCGACACCGACGCGACCGTGGACCCCGCCGCCGCG
GGGCTCACCGTCGACGTGGCCGCCACCGCCGACAAGGCGGCGGACCCGTCCCGTGACCCC
TTCACCGTCATCGGCCGCCTCTTCTCCTCGGGCGAGCGGGACATCGAGCCCGTCGTCTCC
TTCGACGCCGGGAAGGCGCGGGCGGCCGTCGCCGAGACCGCCAAGGAACACGACCGCACG
GTCCGCGAGGGTGCGGTGGCGTTCACGAACGGCAAGGCGGTCGCCACCCAGCCGCGCGAG
GGGCGCGCCCTCGACACGGCGGCGGCCGTCGACGCGCTGCGCGGCGCGTACCCCGCGCCC
GGCGGGGCGGCCCCGGTGGCGCTGCCGGTCTCCGTGACGCAGCCCAGGGTGACGGCGGCC
GAGGTCTCCCGCTTCATGAAGGACTTCGCTACCCCCGCGATGTCGGGTCCGGTCACGCTG
ACCGCCGGCGACAAGCGGCTCGCGATCTCGGCGGCCACCCTGAGCGACCACTTGAAGGTG
ACGTCCGCCGGCGGCCGGCTGAGCTCCTCCCTCGACACCGCCTCCCTCCTGCGCGACCCC
GACGTGGCCCGCCCGCTGGACGCGCTCACCGGCGCCCCGGTCGAGGCGCGGCTCGGCGTC
CAGGACGGCAAGGTCGTCGTGGAGGAGGACGGCCGCCCGGGCCGCGAGGTGTCGGCCACG
GCCCTGGGCCGGGCGGTGGAGCCGCTGCTCACCAAGGAGGGCGCGGCGGCCCGTACCGCA
CCGGTGCCCACGAAGGTGACCCAGCCGCAGCTGACGGCGGCCTCGCTGGCCGCGCTGGGC
ATCAAGGAGCAGATGTCGACGTTCACGGTGAACTTCCCGACGGCTCCTTACCGGACGACC
AACATCGGCCGGGCGGTCGAGCTGATCAACGGCTCGGTGGTGCAGCCGGGCGAGGTGTGG
AGCTTCAACCGCACGGTCGGCGAGCGCACGAAGGCCAACGGCTTCGTGGACGGCACGATG
ATCATGGACGGCCAGTACCAGAAGGCGCCGGGCGGCGGCGTCTCCGCGGTGGCCACCACC
GTCTACAACGCCCTGTTCTTCGCCGGGGTCAAGCCGCTCGAGCACGGCGCTCACTCCTTC
TACATCGAGCGCTACCCGGCGGGCCGCGAGGCGACGGTCGCGTGGGGCACCCTCGACCTG
CGGTTCCGCAACGACTCGGGCAACCCGATCTACATCAAGGCGAGCTCGACGGACTCGTCG
GTGACGGTCAGCTTCCTCGGCACGAAGAAGTACGACTCGGTGGAGGCGGTCGCGGGCCCG
CGGACGAACGTCACACCGCCGGCGGAGCGCGAGGACCCGAGCCCGAAGTGTGAGGTCCAG
GAGCCGCTGGAGGGCTTCGACATCAAGGTCGACCGGGTCTTCAAGAACGGCGGCACCGAG
GTGAAGCGGGAGACGTTCTCGACGCACTACACACCGCGGGACAAGGTGACGTGCGTGGGA
ACGGGTGACGCACCGAAGAAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007391 Vancomycin resistance VanW (Family)
 [377-507]  1.40000000000001e-46 PF04294
PF04294   VanW
IPR022029 Putative peptidoglycan binding domain (Domain)
 [95-196]  9.50000000000001e-06 PF12229
PF12229   PG_binding_4
SignalP
 [1-46]  0.629 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
 [1-39]  0.606 Signal
Bacteria, Gram-negative   
TMHMM
 [23-45]  Transmembrane (i-o)
Transmembrane 1