close all open/close all

CDS information : Ello_00250


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction23,835 / 24,201 / + [in whole cluster]
23,835 / 24,201 / + [in contig]
Location23835..24201 [in whole cluster]
23835..24201 [in contig]
TypeCDS
Length367 bp (121 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)IclR-family regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in elloramycin biosynthesis.
Note (GenBank)
  • ORF8

close this sectionSequence

selected fasta
>[IclR-family regulator]
MPSFPPGPPSTPPGPQSVERALAVLDAVADADRPVPAKALARMLGCALSTVYHLTGPLIA
RGHLVRTPEGYAPGPRVPALHRAYQRHHGLGGGGAGIGELLGVLRRTSGAEAYFTAYRDG
RI-
selected fasta
>[IclR-family regulator]
GTGCCCTCGTTCCCGCCCGGTCCGCCCTCCACTCCTCCCGGTCCCCAGTCCGTCGAGCGT
GCCCTCGCCGTCCTCGACGCCGTCGCCGACGCCGACCGGCCCGTCCCCGCCAAGGCGCTC
GCCCGCATGCTCGGCTGCGCCCTGTCGACCGTCTACCACCTGACAGGTCCGCTCATCGCC
CGCGGCCACCTCGTCCGCACCCCCGAGGGCTACGCCCCGGGCCCGCGCGTCCCCGCCCTC
CACCGCGCCTATCAGCGTCACCACGGTCTCGGCGGCGGCGGGGCCGGCATCGGCGAGCTG
CTCGGGGTGCTGCGCCGCACCTCCGGCGCCGAGGCGTACTTCACCGCCTACCGCGACGGG
CGGATCC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005471 Transcription regulator IclR, N-terminal (Domain)
 [15-75]  12.725 PS51077
PS51077   HTH_ICLR
 [17-67]  7.4e-11 PF09339
PF09339   HTH_IclR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [15-87]  3.2e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit