close all open/close all

CDS information : Ello_00260


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction26,511 / 25,630 / - [in whole cluster]
1,311 / 430 / - [in contig]
Locationcomplement(25630..26511) [in whole cluster]
complement(430..1311) [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-dehydrorhamnose reductase
putative dTDP-4-keto-L-rhamnose reductase
Product (GenBank)4-ketoreductase
Gene
Gene (GenBank)rhaD
EC number1.1.1.133
Keyword
  • L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q93F84
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative dTDP-4-dehydrorhamnose reductase [4-ketoreductase]
MSRWLITGAAGMLGRDLAEVLAESGAEYTALTRKELDITDTAAVRAAVAGHDVVVNAAAW
TDVDGAETEEAAATRINGEGPRALAAACAETGAVLIQVSTDYVFPGDATEPYRHDAPTAP
VNAYGRSKLAGELAVTELLPERGYVVRTAWLYGAHGRNFVSTMLGLAEQRETVDVVDDQR
GQPTWTRALARQLRDLGEAAVAGKAPAGVYHGTAAETATWFDLARAAFELTGLDPERVRP
TTSEKFVRPARRPSYSVLAHERWAEAGVAAQPHWREQLTEALRVMAPGGRSGA
selected fasta
>putative dTDP-4-dehydrorhamnose reductase [4-ketoreductase]
ATGAGCCGCTGGCTGATCACCGGCGCGGCCGGGATGCTCGGCCGCGACCTCGCCGAGGTG
CTCGCGGAGAGCGGCGCGGAGTACACCGCGCTGACCCGCAAGGAGCTGGACATCACCGAC
ACCGCCGCGGTCCGCGCGGCGGTGGCCGGTCACGACGTGGTGGTCAACGCCGCCGCCTGG
ACCGATGTCGACGGCGCCGAGACCGAGGAGGCCGCGGCCACCCGGATCAACGGGGAGGGC
CCGCGGGCCCTCGCTGCGGCCTGCGCCGAGACCGGCGCCGTGCTGATCCAGGTCTCCACG
GACTACGTCTTCCCGGGCGACGCCACCGAGCCGTACCGGCACGACGCGCCCACCGCCCCG
GTGAACGCCTACGGCCGCAGCAAGCTGGCCGGCGAACTGGCCGTCACCGAGCTGCTGCCG
GAGCGCGGCTACGTGGTGCGCACCGCGTGGCTGTACGGGGCGCACGGCCGCAACTTCGTG
TCGACGATGCTGGGCCTGGCCGAGCAGCGCGAGACCGTCGACGTGGTCGACGACCAGCGC
GGCCAGCCGACCTGGACCCGTGCGCTCGCCCGCCAGCTGCGGGACCTGGGCGAGGCGGCC
GTGGCGGGCAAGGCCCCCGCGGGCGTCTACCACGGCACGGCGGCCGAGACGGCGACCTGG
TTCGACCTGGCGCGGGCGGCCTTCGAGCTGACCGGCCTGGATCCGGAGCGGGTGCGGCCG
ACCACCTCGGAGAAGTTCGTGCGCCCGGCGCGCCGTCCGTCCTACAGCGTGCTCGCGCAC
GAGCGGTGGGCCGAGGCGGGCGTGGCGGCGCAGCCGCACTGGCGTGAGCAGCTGACCGAG
GCCCTGCGGGTCATGGCACCGGGCGGACGGTCCGGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005913 dTDP-4-dehydrorhamnose reductase (Family)
 [3-283]  1.10000000000001e-106 PF04321
PF04321   RmlD_sub_bind
 [4-283]  3.99999999999998e-90 TIGR01214
TIGR01214   RmlD
IPR016040 NAD(P)-binding domain (Domain)
 [3-232]  1.6e-59 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.839 Signal
Eukaryota   
TMHMM No significant hit