close all open/close all

CDS information : Ello_00270


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction27,497 / 26,508 / - [in whole cluster]
2,297 / 1,308 / - [in contig]
Locationcomplement(26508..27497) [in whole cluster]
complement(1308..2297) [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)4,6-dehydratase
Gene
Gene (GenBank)rhaB
EC number4.2.1.46
Keyword
  • L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q9ZGH3
NITE
Pikro_00130
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14570895] High resolution X-ray structure of dTDP-glucose 4,6-dehydratase from Streptomyces venezuelae. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [4,6-dehydratase]
MKILVTGGAGFIGSQFVRALLSEELPSGKGAQVTVLDNLTYSGNEANLAPVADKPGYTFV
HGDIRDYAVVDDAMRGQDAVVHFAAESHVDRSILDSSPFVTTNVLGTQVLLDAAKRHGVG
RFVHVSTDEVYGSISEGSWTEDWPLAPNSPYSASKAGSDLLALSYHRTHGMDVVVTRCSN
NYGQYHFPEKMIPLFTTNLLDGKKVPLYGEGLNIRDWLHVSDHCRGIEMVLRGGRAGEVY
HIGGGTEVTNRELTGLLLDACGAGWDMVEHVEDRKGHDLRYSLSIAKIQEELGYTPQVTF
AQGLADTVQWYRDNRAWWEPLKAKAALSA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [4,6-dehydratase]
ATGAAGATTCTCGTTACCGGCGGCGCCGGGTTCATCGGTTCACAGTTCGTGCGGGCACTG
CTCTCCGAAGAGCTGCCCTCGGGCAAGGGTGCCCAGGTCACCGTCCTGGACAACCTGACC
TACTCCGGCAACGAGGCGAACCTCGCCCCGGTGGCGGACAAGCCCGGCTACACCTTCGTC
CACGGCGACATCCGCGACTACGCGGTCGTCGACGACGCCATGCGCGGCCAGGACGCGGTC
GTGCACTTCGCGGCGGAGTCCCACGTGGACCGCTCGATCCTGGACTCCTCGCCGTTCGTC
ACCACGAACGTGCTGGGCACCCAGGTCCTGCTCGACGCGGCCAAGCGCCACGGCGTCGGC
CGCTTCGTCCACGTCTCCACGGACGAGGTCTACGGCTCCATCTCCGAGGGCTCCTGGACC
GAGGACTGGCCGCTCGCGCCGAACTCCCCGTACTCGGCCTCCAAGGCGGGCTCCGACCTG
CTGGCCCTGTCGTACCACCGCACGCACGGCATGGACGTCGTCGTGACCCGCTGCTCCAAC
AACTACGGGCAGTACCACTTTCCCGAGAAGATGATCCCGCTGTTCACCACGAACCTGCTG
GACGGGAAGAAGGTGCCGCTCTACGGCGAGGGCCTGAACATCCGCGACTGGCTGCACGTC
TCCGACCACTGCCGTGGCATCGAGATGGTGCTGCGCGGCGGCCGCGCGGGTGAGGTCTAC
CACATCGGCGGCGGCACCGAGGTCACCAACAGGGAGCTCACCGGTCTCCTCCTGGACGCC
TGCGGCGCCGGCTGGGACATGGTCGAGCACGTCGAGGACCGCAAGGGCCACGACCTGCGC
TACTCGCTGTCGATCGCCAAGATCCAGGAGGAGCTCGGCTACACGCCGCAGGTCACCTTC
GCGCAGGGTCTCGCCGACACCGTGCAGTGGTACCGCGACAACCGCGCCTGGTGGGAGCCG
CTGAAGGCGAAGGCGGCGCTGTCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-243]  1.40000000000001e-64 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-190]  3.79999999999991e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [138-166]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-19]  0.599 Signal
Bacteria, Gram-negative   
 [1-19]  0.66 Signal
Eukaryota   
TMHMM No significant hit