close all open/close all

CDS information : Ello_00280


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction27,601 / 28,482 / + [in whole cluster]
2,401 / 3,282 / + [in contig]
Location27601..28482 [in whole cluster]
2401..3282 [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-D-glucose synthase
Gene
Gene (GenBank)rhaA
EC number2.7.7.24
Keyword
  • L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
P72017
PmId
[9084178] Determination of the pathway for rhamnose biosynthesis in mycobacteria: cloning, sequencing and expression of the Mycobacterium tuberculosis gene encoding alpha-D-glucose-1-phosphate thymidylyltransferase. (Microbiology. , 1997)
[11302803] Drug targeting Mycobacterium tuberculosis cell wall synthesis: genetics of dTDP-rhamnose synthetic enzymes and development of a microtiter plate-based screen for inhibitors of conversion of dTDP-glucose to dTDP-rhamnose. (Antimicrob Agents Chemother. , 2001)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-D-glucose synthase]
MRGILLAGGTGSRLWPITRAVSKQLMPVFDKPMIYYPLSTLVMAGIKDILIITGPEERPQ
FERLLGDGSDFGLDIQFATQEHPNGIAEAFVIGEEFIGDEPVALILGDNIFHGVGLGRQL
ADYSKPEGGVVFAHAVSDPTAYGVVDFDENGVARSIEEKPKNPKSRYAVPGLYFYDSRVV
EIAKGLEPSARGELEITDVNKHYLERGELQVSVLDRGTVWLDTGTFQSLVQASEYVRVVE
ERQGMKIGCLEEAAWRAGFIDDEHLRALAQPLTKSGYGDYLLNLLAYEAEKKA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-D-glucose synthase]
ATGCGTGGAATTTTGCTTGCCGGTGGTACCGGCTCCCGACTGTGGCCGATCACCCGAGCC
GTGTCGAAGCAGCTGATGCCGGTCTTCGACAAGCCGATGATCTATTACCCCCTGTCCACC
CTCGTGATGGCGGGGATCAAGGACATTCTGATCATCACCGGACCGGAGGAGCGGCCCCAG
TTCGAGCGGCTTCTGGGAGATGGGTCCGATTTCGGACTCGACATCCAGTTCGCCACTCAG
GAGCACCCCAACGGAATTGCCGAGGCTTTCGTCATCGGCGAGGAATTCATCGGTGACGAG
CCCGTCGCCCTGATCCTCGGCGACAACATCTTCCACGGTGTCGGTCTCGGCCGACAGCTC
GCGGACTACAGCAAGCCCGAGGGTGGTGTGGTCTTCGCCCACGCCGTCTCCGACCCCACC
GCCTACGGTGTCGTCGACTTCGACGAGAACGGCGTCGCCCGCTCCATCGAGGAGAAGCCG
AAGAACCCCAAGTCCCGCTACGCGGTGCCGGGTCTCTACTTCTACGACAGCCGGGTCGTC
GAGATCGCCAAGGGCCTGGAGCCCAGCGCCCGCGGCGAGCTGGAGATCACCGACGTCAAC
AAGCACTACCTCGAGCGCGGCGAGCTCCAGGTCTCGGTCCTCGACCGCGGCACCGTCTGG
CTCGACACCGGCACCTTCCAGTCCCTCGTCCAGGCCTCCGAGTACGTCCGCGTGGTCGAG
GAGCGCCAGGGCATGAAGATCGGCTGCCTCGAAGAGGCCGCCTGGCGTGCCGGGTTCATC
GACGACGAGCACCTGCGCGCCCTCGCCCAGCCGCTGACCAAGAGCGGCTACGGCGACTAC
CTGCTCAACCTCCTTGCGTACGAGGCCGAGAAGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [3-235]  6.59999999999996e-63 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-285]  TIGR01207
TIGR01207   RmlA
SignalP
 [1-20]  0.673 Signal
Eukaryota   
TMHMM No significant hit