close all open/close all

CDS information : Ello_00290


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction28,500 / 29,105 / + [in whole cluster]
3,300 / 3,905 / + [in contig]
Location28500..29105 [in whole cluster]
3300..3905 [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-dehydrorhamnose 3,5-epimerase
Product (GenBank)3,5-epimerase
Gene
Gene (GenBank)rhaC
EC number5.1.3.13
Keyword
  • L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q9L9E5
PmId
[16514445] Characterisation of Streptomyces spheroides NovW and revision of its functional assignment to a dTDP-6-deoxy-D-xylo-4-hexulose 3-epimerase. (Chem Commun (Camb). , 2006)
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)
ACC
Q93EK2
PmId
[11544225] Rhamnose biosynthesis pathway supplies precursors for primary and secondary metabolism in Saccharopolyspora spinosa. (J Bacteriol. , 2001)
ACC
O06330
PmId
[16472764] rmlB and rmlC genes are essential for growth of mycobacteria. (Biochem Biophys Res Commun. , 2006)

close this sectionSequence

selected fasta
>putative dTDP-4-dehydrorhamnose 3,5-epimerase [3,5-epimerase]
MKVNPLGIEGAWEFVPQQFGDARGLFLEWYKAERMAEAVGHPLNLKQGNLSVSSAGVVRG
IHFADVPPGQAKYVTCVRGAVLDIIVDVRVGSPTFGKWEAVRLDDKDRKAVYLSEGLGHG
FCALTDDATVTYLCSEGYAPERERTVYPLDPEIGIEWPVDGEPELSAKDAQGPTLAQARE
AGILPVYEECVAFRASLAERG
selected fasta
>putative dTDP-4-dehydrorhamnose 3,5-epimerase [3,5-epimerase]
ATGAAGGTCAACCCCCTTGGTATCGAGGGCGCCTGGGAGTTCGTCCCGCAGCAGTTCGGT
GACGCCCGTGGCCTGTTCCTGGAGTGGTACAAGGCCGAGCGCATGGCCGAGGCCGTCGGT
CACCCGCTGAACCTGAAGCAGGGCAACCTCTCCGTCTCCTCCGCCGGTGTCGTCCGCGGC
ATCCACTTCGCCGACGTGCCGCCCGGCCAGGCCAAGTACGTGACCTGCGTCCGCGGCGCG
GTGCTCGACATCATCGTCGACGTCCGCGTCGGCTCGCCGACCTTCGGCAAGTGGGAGGCC
GTGCGCCTCGACGACAAGGACCGCAAGGCCGTCTACCTCTCCGAGGGCCTCGGCCACGGC
TTCTGCGCGCTCACCGACGACGCGACCGTCACCTACCTCTGCTCCGAGGGGTATGCGCCG
GAGCGGGAGCGCACGGTCTACCCGCTCGACCCTGAGATCGGCATCGAGTGGCCGGTCGAC
GGCGAGCCCGAGCTGTCCGCGAAGGACGCCCAGGGCCCGACCCTCGCGCAGGCCCGTGAG
GCCGGCATCCTGCCGGTCTACGAGGAGTGCGTGGCCTTCCGGGCCTCGCTGGCCGAGCGC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-182]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  3.5e-49 TIGR01221
TIGR01221   RmlC
 [5-177]  6.90000000000001e-64 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-182]  9.80000272130214e-73 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-190]  1.79999999999997e-70 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit