close all open/close all

CDS information : Ello_00300


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction29,199 / 30,188 / + [in whole cluster]
3,999 / 4,988 / + [in contig]
Location29199..30188 [in whole cluster]
3999..4988 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative UDP-glucose 4-epimerase
putative UDP-galactose 4-epimerase
Product (GenBank)UDP-D-glucose-4-epimerase
Gene
Gene (GenBank)galE3
EC number5.1.3.2
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Related Reference
ACC
Q9S6S4
PmId
[12533462] Characterization, expression, and mutation of the Lactococcus lactis galPMKTE genes, involved in galactose utilization via the Leloir pathway. (J Bacteriol. , 2003)
ACC
P13226
PmId
[3335481] Gene organization and structure of the Streptomyces lividans gal operon. (J Bacteriol. , 1988)

close this sectionSequence

selected fasta
>putative UDP-glucose 4-epimerase [UDP-D-glucose-4-epimerase]
MTWLITGGAGYIGSHVVKSMTEAGERVVVLDDLSTGDPARVPAGVPLERGTVLDRAFLDR
VLAEHRVRGIVHLAAKKAVGESVERPLHYYRENVTGLQVLLEAAAAAGVDSFLFSSSASV
YGMPDTDLVTEDTPCAPLSPYGETKVAGEWMVRSVGRAHSMATACLRYFNVAGTAAPELA
DTGVFNLVPMVFQRLDAGQPPLVFGDDYATPDGTCVRDYIHVADLADAHLAAARRLAELA
AAGDHRDLTLNIGRGEGVSVREMMDLIREVTGRPVEPEVTARRPGDPAQVVASADRISAE
LGWKARHDVRSMIASAWAAHTGAAVQPAE
selected fasta
>putative UDP-glucose 4-epimerase [UDP-D-glucose-4-epimerase]
ATGACGTGGCTCATCACCGGCGGCGCCGGCTACATCGGTTCCCATGTCGTCAAGTCCATG
ACGGAGGCGGGTGAGCGGGTGGTCGTCCTGGACGACCTCTCCACCGGCGACCCGGCGAGA
GTCCCCGCGGGCGTGCCCCTGGAGCGCGGCACCGTCCTCGACCGGGCCTTCCTCGACCGG
GTCCTCGCCGAGCACCGGGTCCGCGGGATCGTCCACCTCGCCGCGAAGAAGGCCGTCGGC
GAATCCGTCGAACGCCCGCTCCACTACTACCGCGAGAACGTCACGGGCCTGCAGGTCCTG
CTCGAAGCGGCCGCGGCGGCCGGCGTCGACTCCTTCCTCTTCTCCTCCTCGGCCTCCGTG
TACGGCATGCCCGACACCGACCTGGTCACCGAGGACACGCCCTGCGCGCCGCTCAGCCCG
TACGGCGAGACCAAGGTCGCGGGCGAGTGGATGGTCCGCTCCGTCGGCCGTGCCCACTCC
ATGGCCACCGCCTGCCTGCGCTACTTCAACGTCGCCGGCACCGCCGCCCCCGAACTCGCC
GACACCGGCGTCTTCAACCTCGTCCCCATGGTCTTCCAGCGGCTCGACGCCGGGCAGCCG
CCGCTCGTCTTCGGCGACGACTACGCCACTCCCGACGGCACCTGCGTCCGCGACTACATC
CATGTCGCCGACCTCGCCGACGCCCATCTGGCCGCCGCCCGCCGACTCGCCGAACTGGCC
GCGGCCGGGGACCACCGCGACCTCACCCTCAACATCGGGCGCGGGGAGGGCGTCTCCGTA
CGGGAGATGATGGACCTGATCCGCGAGGTCACCGGCCGCCCCGTCGAGCCCGAGGTCACC
GCCCGCCGCCCCGGCGACCCGGCGCAGGTGGTCGCCTCCGCCGACCGGATCTCCGCGGAA
CTGGGCTGGAAGGCCCGCCACGACGTCCGCTCCATGATCGCCTCGGCCTGGGCGGCGCAC
ACCGGGGCCGCGGTCCAGCCCGCGGAATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-237]  5.89999999999994e-55 PF01370
PF01370   Epimerase
IPR005886 UDP-glucose 4-epimerase (Family)
 [4-319]  7.59999999999998e-98 TIGR01179
TIGR01179   GalE
IPR016040 NAD(P)-binding domain (Domain)
 [1-169]  3.2e-58 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR025308 UDP-glucose 4-epimerase C-terminal domain (Domain)
 [268-318]  1e-11 PF13950
PF13950   Epimerase_Csub
SignalP No significant hit
TMHMM No significant hit