close all open/close all
Ello_00300 Ello_00300   last last

CDS information : Ello_00310


close this sectionLocation

Organism
StrainTü2353
Entry nameElloramycin
Contig
Start / Stop / Direction30,244 / 31,386 / + [in whole cluster]
5,044 / 6,186 / + [in contig]
Location30244..31386 [in whole cluster]
5044..6186 [in contig]
TypeCDS
Length1,143 bp (380 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glutamate 5-kinase
putative gamma-glutamyl kinase
Product (GenBank)gamma-glutamyl kinase
Gene
Gene (GenBank)proB
EC number2.7.2.11
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18310024] Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster. (Microbiology. , 2008)
Family/Domain
FD
IPR011529, IPR005715

close this sectionSequence

selected fasta
>putative glutamate 5-kinase [gamma-glutamyl kinase]
MTARTTQVTVARQYVTEARRIVVKVGSSSLTTASGGLDADRVDALVDVLAKVRSGGEKEI
VLVSSGAIAAGLAPLGLTRRPKDLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTT
DDTSRRAHYRNAYRTLDQLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLL
VLLSDVDGLYDGDPAKPGTSRIAEVTGPDDIAHVEIGSAGKAGVGTGGMVTKVEAARIAA
AAGIPVVLTSASRAADALSGRDTGTYFHRTGRRSADRLLWLAHASTPQGALTLDDGAVRA
VVEGKKSLLAAGIAAVEGEFSAGDPVELRDTAGRAVARGLVNFDAKEIPRLLGRSTHELA
KELGPEYEREIVHRDDLVVM
selected fasta
>putative glutamate 5-kinase [gamma-glutamyl kinase]
ATGACGGCGAGGACGACGCAGGTGACAGTGGCCAGGCAGTACGTGACGGAAGCCCGCAGG
ATCGTCGTGAAGGTCGGCTCCTCCTCGCTGACCACGGCCTCCGGCGGGCTCGACGCCGAC
CGGGTCGACGCCCTCGTGGACGTCCTCGCCAAGGTCCGCAGCGGCGGCGAGAAGGAGATC
GTCCTGGTCTCCTCCGGCGCCATCGCCGCGGGCCTCGCCCCGCTCGGCCTCACCCGCCGC
CCCAAGGACCTCGCCCGGCAGCAGGCCGCCGCCAGCGTCGGCCAGGGGCTGCTCGTCGCC
CGCTACACCGCCTCCTTCGCGCGCTACGGCGTCCGCGTCGGCCAGGTCCTGCTCACCACC
GACGACACCAGCCGCCGCGCGCACTACCGCAACGCCTACCGGACCCTCGACCAGCTGCTC
GCCATGGGCGCCCTGCCGGTCGTCAACGAGAACGACACCGTCGCCACGGACGAGATCCGC
TTCGGAGACAACGACCGGCTCGCCGCCCTCGTCGCCCATCTCGTCCGCGCCGACCTGCTC
GTCCTCCTCTCCGACGTGGACGGGCTCTACGACGGCGATCCCGCCAAGCCCGGCACCTCG
CGGATCGCCGAGGTCACCGGACCGGACGACATCGCCCACGTCGAGATCGGCTCGGCCGGC
AAGGCGGGCGTCGGCACCGGCGGCATGGTCACCAAGGTCGAGGCGGCCCGGATCGCGGCC
GCCGCCGGCATCCCCGTCGTCCTCACCTCCGCCAGCCGTGCCGCCGACGCCCTGTCCGGC
CGGGACACCGGCACCTACTTCCACCGCACCGGCCGCCGCTCCGCCGACCGGCTGCTCTGG
CTCGCGCACGCCTCCACCCCGCAGGGCGCGCTGACCCTCGACGACGGCGCCGTCCGAGCC
GTGGTCGAGGGCAAGAAGTCGCTGCTCGCGGCCGGAATCGCCGCCGTCGAGGGCGAGTTC
AGCGCCGGCGACCCGGTGGAGCTGCGCGACACCGCGGGCCGCGCGGTCGCCCGGGGACTC
GTCAACTTCGACGCCAAGGAGATCCCCCGGCTCCTCGGCCGCTCCACCCACGAACTGGCC
AAGGAGCTCGGCCCGGAGTACGAGCGCGAGATCGTGCACCGCGACGACCTGGTCGTGATG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001048 Aspartate/glutamate/uridylate kinase (Domain)
 [20-250]  1.70000000000001e-39 PF00696
PF00696   AA_kinase
 [5-268]  6.29999999999998e-50 G3DSA:3.40.1160.10
G3DSA:3.40.1160.10   Aa_kinase
 [19-270]  2.9000035467798e-62 SSF53633
SSF53633   Aa_kinase
IPR001057 Glutamate/acetylglutamate kinase (Family)
 [57-71]  7.2000271977897e-53 PR00474 [91-119]  7.2000271977897e-53 PR00474 [131-152]  7.2000271977897e-53 PR00474 [163-190]  7.2000271977897e-53 PR00474 [224-244]  7.2000271977897e-53 PR00474
PR00474   GLU5KINASE
IPR002478 Pseudouridine synthase/archaeosine transglycosylase (Domain)
 [288-366]  PS50890
PS50890   PUA
 [289-361]  5.5e-18 PF01472
PF01472   PUA
 [289-368]  2.49999811956465e-21 SM00359
SM00359   PUA
IPR005715 Glutamate 5-kinase/delta-1-pyrroline-5-carboxylate synthase (Family)
 [19-378]  1.60000000000002e-127 TIGR01027
TIGR01027   ProB
IPR011529 Glutamate 5-kinase (Family)
 [11-380]  PIRSF000729
PIRSF000729   GK
IPR015947 PUA-like domain (Domain)
 [288-380]  3.80000697093586e-25 SSF88697
SSF88697   PUA-like
IPR019797 Glutamate 5-kinase, conserved site (Conserved_site)
 [222-239]  PS00902
PS00902   GLUTAMATE_5_KINASE
SignalP No significant hit
TMHMM No significant hit
Ello_00300 Ello_00300   last last