close all open/close all
first first   Enter_00020 Enter_00020

CDS information : Enter_00010


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction513 / 1,004 / + [in whole cluster]
513 / 1,004 / + [in contig]
Location513..1004 [in whole cluster]
513..1004 [in contig]
TypeCDS
Length492 bp (163 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MerR family transcriptional regulator
Product (GenBank)putative regulatory protein EncE
Gene
Gene (GenBank)encE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
Related Reference
ACC
Q93TP7
PmId
[11282588] Chromosomal locus for cadmium resistance in Pseudomonas putida consisting of a cadmium-transporting ATPase and a MerR family response regulator. (Appl Environ Microbiol. , 2001)
Family/Domain
FD
IPR000551, IPR015358

close this sectionSequence

selected fasta
>putative MerR family transcriptional regulator [putative regulatory protein EncE]
MAQERRMQIGEVAERTGLSLRTIRHYEEVGLIVPSARSKGGFPLYTQADVSRLMVIRRMK
PLDFSLEEMRDLLEITDRLGAQDDPPAPVERERLRERLDAYRKVADARCETLRARLAMAE
DFAATWRDGMNADARARSASERATSGGPLRRLWLTSDAPGLAG
selected fasta
>putative MerR family transcriptional regulator [putative regulatory protein EncE]
ATGGCGCAAGAGCGGCGCATGCAGATCGGCGAGGTCGCCGAGCGCACAGGATTGTCGTTG
CGCACGATCCGGCACTACGAAGAGGTCGGCCTCATCGTTCCCTCCGCCCGCAGCAAGGGC
GGCTTCCCTCTCTACACTCAGGCCGACGTCAGTCGGCTCATGGTGATTCGGCGTATGAAG
CCGCTGGATTTCTCCCTTGAGGAGATGCGGGACCTGCTGGAGATCACTGACAGGCTCGGC
GCCCAGGATGATCCGCCCGCACCTGTGGAGCGCGAGCGACTCCGTGAGCGACTTGACGCG
TACCGCAAGGTGGCCGACGCGCGGTGCGAGACACTGCGCGCGCGACTGGCGATGGCCGAG
GACTTCGCCGCCACGTGGCGTGACGGGATGAATGCGGATGCCCGAGCTCGGTCGGCAAGT
GAGCGGGCTACTTCCGGGGGCCCTCTGCGGAGGCTCTGGCTCACGAGTGATGCACCCGGT
CTTGCCGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000551 Transcription regulator HTH, MerR (Domain)
 [9-45]  8.9e-13 PF00376
PF00376   MerR
 [7-76]  8.49999291746323e-32 SM00422
SM00422   HTH_MERR
 [8-19]  4.39999967439747e-07 PR00040 [19-32]  4.39999967439747e-07 PR00040 [43-63]  4.39999967439747e-07 PR00040
PR00040   HTHMERR
 [10-32]  PS00552
PS00552   HTH_MERR_1
 [6-75]  PS50937
PS50937   HTH_MERR_2
IPR009061 DNA binding domain, putative (Domain)
 [7-133]  2.49999811956465e-26 SSF46955
SSF46955   Putativ_DNA_bind
IPR015358 Transcription regulator MerR, DNA binding (Domain)
 [50-100]  2.1e-08 PF09278
PF09278   MerR-DNA-bind
SignalP No significant hit
TMHMM No significant hit
first first   Enter_00020 Enter_00020