close all open/close all

CDS information : Enter_00030


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction3,163 / 2,672 / - [in whole cluster]
3,163 / 2,672 / - [in contig]
Locationcomplement(2672..3163) [in whole cluster]
complement(2672..3163) [in contig]
TypeCDS
Length492 bp (163 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)EncG
Gene
Gene (GenBank)encG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
Related Reference
ACC
Q2PA04
NITE
Stref_00110
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q9ZAT9
NITE
Adria_00050
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [EncG]
MTTAGADPTQAEESALTQAPHKPEETAALFAEIQQFYGRHMRAMDEGRVEDWTGDFMPDA
VFATNARPEPQRGRAEIARNAEAAARQLQEKGILRRHCVTTLELQQASGLTLLAKTYALI
TKTVVGGRSELEFVCTCEDVLVRNEGRWFIRHRQVFRDDLPKR
selected fasta
>hypothetical protein [EncG]
GTGACTACGGCAGGAGCTGACCCGACCCAAGCAGAGGAGAGCGCCTTGACACAGGCCCCG
CACAAGCCGGAGGAGACCGCGGCGTTGTTCGCAGAGATTCAGCAGTTCTACGGGCGCCAC
ATGCGGGCCATGGACGAAGGCCGAGTGGAGGACTGGACCGGCGACTTCATGCCCGACGCG
GTCTTCGCGACCAACGCCCGACCCGAGCCCCAGCGCGGGCGGGCCGAGATCGCCCGAAAC
GCGGAGGCCGCAGCGCGGCAGCTGCAGGAGAAGGGCATCCTGCGCCGCCACTGCGTCACC
ACCCTGGAACTCCAGCAGGCGAGTGGACTGACGCTCCTGGCCAAGACCTACGCCCTGATC
ACCAAGACGGTGGTGGGAGGCCGGTCGGAGCTGGAGTTCGTGTGTACCTGCGAGGACGTG
CTCGTCCGGAACGAGGGCCGATGGTTCATCCGGCACCGCCAGGTCTTCCGGGACGATCTC
CCCAAGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit