close all open/close all

CDS information : Enter_00040


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction3,330 / 4,937 / + [in whole cluster]
3,330 / 4,937 / + [in contig]
Location3330..4937 [in whole cluster]
3330..4937 [in contig]
TypeCDS
Length1,608 bp (535 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productcinnamic acid--CoA ligase
cinnamoyl-CoA synthetase
Product (GenBank)putative acyl-CoA ligase EncH
Gene
Gene (GenBank)encH
EC number6.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[12511484] Characterization of benzoyl coenzyme A biosynthesis genes in the enterocin-producing bacterium "Streptomyces maritimus". (J Bacteriol. , 2003)
Related Reference
ACC
Q9EY88
PmId
[11152072] Identification of Amycolatopsis sp. strain HR167 genes, involved in the bioconversion of ferulic acid to vanillin. (Appl Microbiol Biotechnol. , 2000)

close this sectionSequence

selected fasta
>cinnamic acid--CoA ligase [putative acyl-CoA ligase EncH]
MEPAPQAPTQPVIDARRPEAGPRWETIGELIKDAALLHGDKEFLRCGDKTLSFSETDTRT
DRLAQALIAQGVKPGDRVAVMMDNVADWPLSWFAAIKAGAITVPVNTRFGATDLAHVLKD
SQAVRVLASPGCVPLARDVSGSIGHPCAVRTLRELEADFGDRPVDGPGLSAHADDTVNFQ
YTSGTTGFPKACMLSHDYWLRTAWMIAVHSGLRPDDVVLTAQAFSYMDPQWKAVMCLMGG
VPLVVLPRFSASGFWHSVRQHRATLTYVLGSMPMLLYKQPPHSGDRDHAMRLVLCSGIPR
DLHHAFEDRWGAAWREVYGSTESGLDLIMPPGEEATVGSGAMGYPPSGKEVIVADERQRP
VQPGQIGEILVRGRPMMKGYWNNPDSTERAFRGGWYHTGDLGRAEAAGSVVHAGRLKDMI
RRGGENIAAAEVESVLEAHPAVLAAALAGIPDELFGELPKAFLQLRPGYRPTTATARSVL
AHTRRHLAKFKVPAYVEFVDSFPMTPSARIQKRQLLRPGDDQRTGAFDAAADAWA
selected fasta
>cinnamic acid--CoA ligase [putative acyl-CoA ligase EncH]
ATGGAACCGGCCCCTCAGGCCCCCACACAACCTGTGATCGACGCTCGGCGCCCCGAAGCG
GGACCGCGTTGGGAGACCATCGGCGAGCTCATCAAAGATGCCGCGTTGCTGCACGGCGAC
AAGGAATTCCTCCGATGCGGCGACAAGACGCTCAGCTTCTCCGAGACCGACACCCGCACC
GACCGGTTGGCGCAGGCGCTGATCGCCCAAGGTGTCAAACCGGGTGACCGTGTCGCGGTC
ATGATGGACAACGTGGCGGACTGGCCGTTGAGCTGGTTCGCGGCCATCAAGGCCGGTGCC
ATCACGGTGCCGGTCAACACCCGCTTCGGCGCTACGGACCTCGCGCACGTCCTGAAGGAC
TCTCAGGCCGTGCGGGTCCTGGCCTCCCCAGGCTGCGTGCCTTTGGCCCGTGACGTGAGC
GGCAGCATCGGGCACCCCTGTGCGGTCCGGACGCTACGCGAACTGGAGGCCGACTTCGGC
GACCGGCCGGTGGACGGTCCGGGCCTGTCGGCGCACGCGGACGACACCGTCAACTTCCAG
TACACCTCCGGCACCACAGGCTTTCCGAAAGCCTGCATGCTCAGCCACGACTACTGGCTG
CGCACGGCGTGGATGATCGCTGTCCACTCCGGCCTCCGTCCCGACGACGTCGTGCTGACG
GCCCAGGCGTTCTCCTACATGGATCCCCAGTGGAAAGCCGTGATGTGCCTGATGGGCGGC
GTTCCGCTGGTGGTGCTCCCGCGGTTCTCCGCCTCCGGCTTCTGGCACTCCGTCCGCCAG
CACCGGGCCACGCTGACCTACGTGCTGGGCAGCATGCCCATGCTGCTGTACAAGCAGCCG
CCCCACTCGGGCGACCGCGATCATGCGATGCGGCTGGTCTTGTGCTCGGGCATCCCGCGC
GACTTGCACCATGCGTTCGAGGACCGCTGGGGTGCGGCCTGGCGGGAGGTGTACGGCTCC
ACCGAGAGCGGACTGGACTTGATCATGCCGCCTGGTGAGGAGGCCACCGTGGGCAGCGGC
GCGATGGGGTACCCGCCGTCCGGCAAGGAGGTCATCGTCGCCGACGAGCGCCAACGCCCC
GTCCAGCCAGGGCAGATCGGCGAGATCCTGGTGCGGGGAAGGCCCATGATGAAAGGCTAC
TGGAACAACCCGGACAGTACCGAGCGGGCGTTCCGCGGCGGCTGGTACCACACCGGTGAC
CTCGGACGTGCCGAGGCGGCCGGGAGCGTGGTGCACGCCGGGCGGCTGAAGGACATGATC
CGACGCGGTGGGGAGAACATCGCAGCGGCCGAAGTCGAGAGCGTCCTCGAAGCCCACCCG
GCGGTCCTGGCCGCCGCGCTCGCCGGCATCCCCGACGAGCTCTTCGGTGAGCTGCCCAAA
GCCTTCCTGCAGCTGCGCCCCGGCTACCGGCCCACCACGGCAACGGCTCGCAGCGTCCTC
GCGCACACCCGCCGCCACCTCGCGAAATTCAAGGTCCCTGCCTATGTCGAATTCGTCGAC
TCCTTCCCCATGACCCCCTCCGCCCGTATCCAGAAGCGCCAGCTGCTTCGTCCCGGAGAC
GACCAGCGCACCGGTGCGTTCGACGCCGCAGCGGATGCATGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [52-446]  1.99999999999999e-92 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [179-190]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [490-515]  2.1e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit