close all open/close all

CDS information : Enter_00050


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction4,934 / 5,710 / + [in whole cluster]
4,934 / 5,710 / + [in contig]
Location4934..5710 [in whole cluster]
4934..5710 [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative cinnamoyl-CoA hydratase
Product (GenBank)putative enoyl-CoA hydratase EncI
Gene
Gene (GenBank)encI
EC number4.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[12511484] Characterization of benzoyl coenzyme A biosynthesis genes in the enterocin-producing bacterium "Streptomyces maritimus". (J Bacteriol. , 2003)
Related Reference
ACC
P52046
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative cinnamoyl-CoA hydratase [putative enoyl-CoA hydratase EncI]
MSDVQQLLSSADLTVTVDSDVAVIAMSRPAKLNALTRGMRRDLAELLRHYGDGSQARGVV
ITGQAKAFSAGMDLREVAGPEVDLLAEMELFNDITRAALITEVPVVAALNGIAVGGAGEM
ALSFDARIATAQAAISWPETGVGLTVSNAASLFLPRLAGAPRALHLIMNSARLSASQALA
LGLLDDIVEPDDLIPAAIRLIHQWTPPGSSTAAHLRLMRPSLRAVEAAMAREGAAVRQVQ
ESGIAQAGIATVLAGHEK
selected fasta
>putative cinnamoyl-CoA hydratase [putative enoyl-CoA hydratase EncI]
ATGAGCGACGTACAGCAGTTGCTGAGCTCCGCCGACCTGACCGTCACGGTCGACAGCGAT
GTTGCTGTGATCGCGATGAGCCGTCCGGCGAAACTCAACGCCCTGACCCGCGGCATGCGC
CGGGACCTGGCCGAGCTGCTGCGCCACTACGGCGACGGCAGCCAGGCTCGCGGAGTGGTG
ATCACCGGCCAGGCAAAAGCCTTCTCTGCCGGAATGGACCTGCGCGAAGTCGCCGGCCCG
GAAGTCGACTTGCTGGCGGAGATGGAGCTGTTCAACGACATCACCCGCGCCGCTCTCATC
ACGGAAGTCCCGGTCGTGGCCGCCCTCAACGGCATCGCCGTCGGCGGCGCCGGTGAGATG
GCCCTGAGCTTCGACGCCCGCATCGCCACCGCTCAGGCCGCGATCTCATGGCCGGAGACA
GGTGTCGGGCTCACCGTGTCCAATGCCGCGAGCCTGTTCCTGCCCCGCCTCGCTGGCGCA
CCCCGAGCCCTGCACCTGATCATGAACAGTGCCCGGCTCAGCGCCTCCCAGGCACTGGCC
CTCGGTCTCCTCGACGACATCGTCGAGCCGGACGATCTCATCCCCGCCGCCATCCGGCTG
ATCCACCAGTGGACGCCGCCGGGTTCGTCCACGGCCGCACATCTGAGGCTGATGCGGCCC
TCGCTGCGTGCGGTAGAAGCGGCCATGGCACGCGAGGGCGCGGCCGTACGGCAGGTCCAG
GAGAGCGGCATTGCCCAGGCCGGCATCGCCACGGTGCTGGCTGGCCACGAAAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [16-239]  2.89999999999999e-42 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit