close all open/close all

CDS information : Enter_00060


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction7,058 / 5,856 / - [in whole cluster]
7,058 / 5,856 / - [in contig]
Locationcomplement(5856..7058) [in whole cluster]
complement(5856..7058) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3-keto-3-phenylpropionyl-CoA thiolase
Product (GenBank)putative beta-oxoacyl-CoA thiolase EncJ
Gene
Gene (GenBank)encJ
EC number2.3.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[12511484] Characterization of benzoyl coenzyme A biosynthesis genes in the enterocin-producing bacterium "Streptomyces maritimus". (J Bacteriol. , 2003)
Related Reference
ACC
P0C7L2
PmId
[17259607] Characterization of the last step of the aerobic phenylacetic acid degradation pathway. (Microbiology. , 2007)
[20660314] Bacterial phenylalanine and phenylacetate catabolic pathway revealed. (Proc Natl Acad Sci U S A. , 2010)

close this sectionSequence

selected fasta
>putative 3-keto-3-phenylpropionyl-CoA thiolase [putative beta-oxoacyl-CoA thiolase EncJ]
MTSGATYRDAAIPLTALWTSPFARWGGALSHLSSLDLAVAATGRALSERGIDRDTIEGMV
LGWTVPQPAIFYGATTLAARLGMPQVSGPMLNQACATSVAALHQAAAAVGTGVGPQLIVT
TDRTSNGPDLSWPSPAGSEQGPVRENWVRDSFSQDPVTGQSMLATAEAVAAECGFTRDDL
DALAVLRSEQYTAALSDDRTFQRDFMVGIEIEQDGLGTVRLLSDEGVRPVTADSAGQLPT
VRPGGVHTAATQTHPADGTAGALVTTTPCAREFADRGPIVRLVASGFARVEPARMPRALV
PAAQAALHAAGLKIDTMDAISTHNPFAVNDLYFARETGVTLEAMNASGCSLLFGHPQGPT
GLRTVTELAHVLKARGGGLGLFTGCAAGDTAAALIIEVTD
selected fasta
>putative 3-keto-3-phenylpropionyl-CoA thiolase [putative beta-oxoacyl-CoA thiolase EncJ]
ATGACGTCCGGGGCCACCTACCGTGATGCGGCCATTCCCCTGACGGCGCTGTGGACCTCG
CCCTTCGCGCGGTGGGGAGGCGCCCTGTCCCACCTCTCCAGCCTCGACCTGGCCGTGGCC
GCCACCGGCCGGGCACTGTCGGAGCGCGGCATCGACCGCGACACCATCGAGGGCATGGTG
CTGGGCTGGACCGTGCCGCAGCCCGCCATCTTCTACGGAGCCACCACGCTCGCGGCCCGA
CTGGGCATGCCCCAGGTCTCCGGACCGATGCTCAACCAAGCCTGCGCCACCTCCGTCGCG
GCCCTGCACCAGGCCGCCGCGGCAGTAGGAACAGGAGTCGGCCCACAACTGATCGTCACC
ACCGACCGCACCAGCAACGGCCCGGACCTCTCCTGGCCCTCACCCGCCGGTTCCGAGCAG
GGACCGGTGCGCGAGAACTGGGTACGCGACAGCTTCTCCCAGGACCCCGTCACCGGACAG
AGCATGCTCGCCACAGCCGAAGCCGTCGCGGCCGAGTGCGGCTTCACCCGCGACGACCTG
GATGCCCTCGCCGTCCTGCGCTCCGAGCAGTACACCGCCGCGCTCAGCGACGACCGCACC
TTCCAGCGTGACTTCATGGTCGGCATCGAGATCGAACAGGACGGGCTCGGCACCGTACGG
CTCTTGTCCGACGAAGGCGTGCGGCCGGTCACGGCCGACAGCGCCGGTCAACTCCCGACG
GTCCGCCCCGGCGGCGTCCACACCGCCGCCACGCAAACGCATCCCGCCGACGGCACAGCG
GGGGCCCTGGTGACCACGACACCGTGCGCCCGGGAATTCGCCGACCGCGGCCCGATCGTG
CGCCTGGTCGCATCCGGATTCGCCCGCGTGGAGCCGGCGCGCATGCCCAGGGCACTCGTT
CCGGCCGCGCAGGCGGCGCTGCACGCCGCCGGGCTGAAGATCGACACGATGGATGCCATC
AGCACCCACAACCCCTTCGCGGTGAACGACCTGTACTTCGCCCGGGAAACCGGGGTGACG
CTGGAGGCCATGAACGCGTCCGGCTGCAGCCTCCTCTTCGGACACCCCCAAGGCCCGACC
GGGCTGCGGACGGTCACGGAACTCGCACACGTACTGAAGGCACGAGGCGGAGGGCTGGGA
CTGTTCACCGGGTGCGCCGCAGGGGACACCGCGGCAGCACTGATCATCGAAGTGACCGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002155 Thiolase (Family)
 [9-400]  6.40004254961849e-111 PIRSF000429
PIRSF000429   Ac-CoA_Ac_transf
IPR016038 Thiolase-like, subgroup (Domain)
 [20-129]  2.2e-16 G3DSA:3.40.47.10 [159-200]  1.3e-31 G3DSA:3.40.47.10 [201-271]  2.2e-16 G3DSA:3.40.47.10 [285-396]  1.3e-31 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [11-274]  2.69998997787809e-33 SSF53901 [277-399]  8.49999291746323e-30 SSF53901
SSF53901   Thiolase-like
IPR020615 Thiolase, acyl-enzyme intermediate active site (Active_site)
 [91-109]  PS00098
PS00098   THIOLASE_1
IPR020616 Thiolase, N-terminal (Domain)
 [20-265]  1.7e-16 PF00108
PF00108   Thiolase_N
IPR020617 Thiolase, C-terminal (Domain)
 [279-397]  1.9e-21 PF02803
PF02803   Thiolase_C
SignalP
 [1-40]  0.383 Signal
Bacteria, Gram-positive   
 [1-40]  0.815 Signal
Eukaryota   
TMHMM No significant hit