close all open/close all

CDS information : Enter_00070


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction7,798 / 7,073 / - [in whole cluster]
7,798 / 7,073 / - [in contig]
Locationcomplement(7073..7798) [in whole cluster]
complement(7073..7798) [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductSAM-dependent O-methyltransferase
Product (GenBank)putative O-methyl transferase EncK
Gene
Gene (GenBank)encK
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>SAM-dependent O-methyltransferase [putative O-methyl transferase EncK]
MTIDASPESSAFGFEGQSYYEHRRLRLYDAVVVHASNRLLWRCPKSRLLEHYNDWITSRH
LEVGPGSGYYLDHCRFPAGTPELTLLDLNPDPLKFAAHRLRRYTPRCVQADILEPLPDFV
GSGFTSIAYNYVMHCLPEPPGGKQIVFKHLREALAPDGVLFGSTVLSQGVKHTALSRRFN
ILYQRQGSFHNQHDSVHGLHQALEEHFASHWIEVRGSVALFAARASQTTAPRHPGASLDQ
R
selected fasta
>SAM-dependent O-methyltransferase [putative O-methyl transferase EncK]
ATGACCATCGATGCATCCCCCGAGTCCTCCGCCTTCGGCTTCGAGGGCCAGTCCTACTAC
GAACACCGGCGGCTGCGCCTGTATGACGCCGTGGTCGTCCATGCGTCGAACCGGCTGCTG
TGGCGCTGCCCGAAGTCACGGCTGCTCGAGCACTACAACGACTGGATCACCTCCCGCCAC
CTGGAGGTCGGCCCCGGCTCGGGCTACTACCTGGACCACTGCCGCTTCCCCGCAGGCACA
CCCGAGCTGACCCTGCTCGACCTCAACCCCGACCCGCTCAAGTTCGCCGCGCACCGCCTG
CGCCGCTACACCCCGCGCTGCGTGCAGGCGGACATCCTGGAACCCTTGCCCGACTTCGTC
GGCAGCGGATTCACATCCATCGCCTACAACTACGTCATGCACTGCCTGCCCGAGCCACCG
GGCGGCAAGCAGATCGTCTTCAAGCACCTGCGCGAGGCACTCGCGCCCGACGGCGTCCTC
TTCGGCAGCACCGTCCTGTCCCAGGGCGTGAAACACACCGCCCTCTCCCGCCGCTTCAAC
ATCCTCTACCAGCGCCAGGGCTCCTTCCACAACCAGCATGACAGCGTCCACGGACTGCAC
CAGGCCCTGGAGGAACACTTCGCCAGCCACTGGATCGAGGTACGCGGCAGCGTCGCACTC
TTCGCGGCCCGCGCATCGCAGACCACCGCGCCCCGCCACCCCGGAGCATCCCTGGACCAG
CGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016584 S-adenosyl-L-methionine dependent methyltransferase, YbcY, predicted (Family)
 [1-228]  PIRSF011491
PIRSF011491   Mtase_YbcY_prd
SignalP No significant hit
TMHMM No significant hit