close all open/close all

CDS information : Enter_00080


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction8,626 / 7,826 / - [in whole cluster]
8,626 / 7,826 / - [in contig]
Locationcomplement(7826..8626) [in whole cluster]
complement(7826..8626) [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)putative ketoreductase EncD
Gene
Gene (GenBank)encD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[15123240] Context-dependent behavior of the enterocin iterative polyketide synthase; a new model for ketoreduction. (Chem Biol. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [putative ketoreductase EncD]
MPAHTESPSVALVTGGTSGIGLSIAQALLQDGLKVIITGRDPGKLETVVRSLKMEDDQFD
VAGYTCDVRDRDAVHDMVERCAKEHGEPKVLVNNAGRSGGGVTAAIPDELWLDVINTNLN
SVFWVTREVIRSSDAIKQPAGRIINIASTGGKQGVPYGAPYSAAKAGVIGFTKALAKEFA
AHGGPTVNAVCPGYVETPMAQDIRASYAKLNNVTEEQVLADFEAKIPLGRYCTPEEVAGM
VRYLVSPAAASVTAQALNVCGGLGSY
selected fasta
>polyketide C-9 ketoreductase [putative ketoreductase EncD]
ATGCCCGCACACACCGAGTCCCCAAGCGTCGCTCTGGTCACAGGCGGCACCAGCGGCATT
GGTCTGTCGATCGCCCAGGCCCTGCTGCAGGATGGGCTGAAGGTCATCATCACCGGCCGC
GACCCCGGGAAGCTGGAGACCGTCGTCAGGTCGCTGAAGATGGAGGACGACCAGTTCGAC
GTGGCCGGTTACACCTGCGACGTACGAGACCGCGACGCGGTGCACGACATGGTGGAACGG
TGCGCCAAGGAGCACGGCGAGCCGAAGGTCCTGGTCAACAACGCCGGCCGCAGCGGCGGC
GGCGTGACCGCCGCGATCCCCGACGAGTTGTGGCTGGACGTCATCAACACCAACCTCAAC
AGCGTCTTCTGGGTGACCCGCGAGGTCATCCGGAGCAGCGACGCGATCAAGCAGCCAGCC
GGCCGGATCATCAACATCGCGTCCACCGGCGGCAAGCAGGGCGTCCCGTACGGGGCCCCG
TACTCGGCGGCCAAGGCCGGTGTCATCGGCTTCACCAAGGCACTCGCCAAGGAATTCGCC
GCCCACGGCGGCCCCACCGTGAACGCGGTATGCCCCGGCTACGTGGAAACGCCCATGGCC
CAGGACATCCGCGCCAGTTACGCCAAGCTCAACAACGTCACCGAGGAGCAGGTCCTCGCC
GACTTCGAGGCCAAAATCCCCCTCGGCCGCTACTGCACCCCCGAGGAGGTGGCGGGCATG
GTGCGCTACCTGGTCAGCCCGGCAGCCGCGTCGGTGACCGCCCAGGCACTCAACGTCTGC
GGCGGACTGGGCAGTTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [86-97]  4.00000300869883e-13 PR00080 [141-149]  4.00000300869883e-13 PR00080 [161-180]  4.00000300869883e-13 PR00080
PR00080   SDRFAMILY
 [10-179]  2.4e-34 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  2.60000517657733e-43 PR00081 [86-97]  2.60000517657733e-43 PR00081 [135-151]  2.60000517657733e-43 PR00081 [161-180]  2.60000517657733e-43 PR00081 [183-200]  2.60000517657733e-43 PR00081 [227-247]  2.60000517657733e-43 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [8-263]  3.10000000000005e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [148-176]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-25]  0.506 Signal
Eukaryota   
 [1-27]  0.279 Signal
Bacteria, Gram-positive   
TMHMM No significant hit