close all open/close all

CDS information : Enter_00090


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction8,815 / 10,086 / + [in whole cluster]
8,815 / 10,086 / + [in contig]
Location8815..10086 [in whole cluster]
8815..10086 [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)putative keto synthase alpha EncA
Gene
Gene (GenBank)encA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[15123240] Context-dependent behavior of the enterocin iterative polyketide synthase; a new model for ketoreduction. (Chem Biol. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionPKS/NRPS Module

KS3..376

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative keto synthase alpha EncA]
MSRHVVITGLSVLAPGSTDTEGFWKMITAGRSAIRRITAFDPTPFRSQVAGEVDLDPLAC
GFSRREVRRLDRASLLAVACARRAVAEAGITSGTSIDPGRIGVSVGNAVGSATSIENEYV
VLSDEGRQWLVDQKYQSPHLFDYFVPGSLARETAWAAGAEGPVSVISAGCTSGIDALGHA
CQLIQEGSADVMVAGATDAPVTPIAVACFDAIKATTRRNDDPEHAPRPFDRTRDGFAIAE
GAAMLVLEDSEHARRRGADIYGTITGYAAHSNAYHMTGLSRDGNEMARAITTALDEARTD
PTAVGYINAHGSGTKQNDLHETEAFKKALGEHAYNVPVSSIKSMIGHSLGAIGAIEVATC
ALAIRNGVVPPTANLHEPDPDCDLDYVPLEARDVDLDVVLTVGSGFGGFQSAMIVEKWRG
GHV
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative keto synthase alpha EncA]
GTGAGCCGACACGTAGTCATAACTGGCCTGAGCGTCCTCGCACCCGGTTCGACGGATACA
GAGGGCTTCTGGAAGATGATCACAGCGGGGCGCAGCGCGATCCGCAGGATCACGGCATTC
GACCCCACGCCGTTCCGTTCCCAGGTGGCGGGAGAGGTCGATCTCGATCCGCTGGCCTGT
GGGTTCAGCCGCCGCGAGGTCCGGCGTCTGGACCGGGCCAGCCTGCTGGCCGTGGCCTGC
GCCAGACGGGCGGTGGCGGAAGCCGGGATCACCTCCGGTACGAGTATCGACCCTGGCCGC
ATCGGTGTGAGCGTGGGCAACGCGGTGGGATCCGCCACAAGTATCGAGAACGAGTACGTC
GTGCTGTCCGACGAGGGACGCCAGTGGCTGGTCGACCAGAAGTACCAGTCCCCCCACCTG
TTCGACTACTTCGTCCCGGGTTCCCTCGCCCGCGAGACCGCCTGGGCGGCCGGTGCCGAA
GGACCGGTGTCGGTCATCTCGGCCGGCTGCACCTCTGGCATCGACGCCCTCGGCCATGCC
TGCCAGCTCATCCAGGAGGGCAGTGCCGACGTGATGGTCGCCGGCGCCACCGATGCTCCC
GTCACCCCGATCGCGGTGGCCTGCTTCGATGCGATCAAGGCCACCACGCGCCGTAACGAC
GATCCCGAACACGCGCCGCGGCCCTTCGACCGCACCCGGGACGGATTCGCCATCGCCGAG
GGCGCGGCCATGCTGGTCCTGGAGGACAGCGAACACGCCCGGCGGCGCGGAGCCGACATT
TACGGCACCATCACCGGATACGCCGCGCACTCGAACGCGTACCACATGACGGGCCTGTCC
CGGGACGGCAATGAGATGGCCCGCGCCATCACGACCGCCCTGGACGAGGCCCGCACCGAC
CCCACGGCCGTCGGGTACATCAACGCCCACGGCTCTGGCACGAAACAGAACGACCTGCAT
GAAACCGAGGCGTTCAAGAAGGCCCTGGGCGAGCACGCTTACAACGTCCCGGTCAGCTCC
ATCAAGTCGATGATCGGGCATTCCCTGGGCGCGATCGGCGCGATCGAGGTTGCAACCTGC
GCGCTGGCCATCCGCAACGGAGTGGTGCCCCCCACCGCGAACCTCCATGAGCCCGACCCG
GACTGCGACCTGGACTACGTCCCCCTTGAGGCGCGTGATGTGGACCTTGACGTCGTCCTG
ACCGTGGGCAGCGGGTTCGGGGGGTTCCAGAGCGCCATGATCGTGGAGAAGTGGCGAGGA
GGCCACGTATGA
KS3..376
KS7..1128

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-252]  6.59999999999996e-56 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-376]  1.40000000000001e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-264]  1.2e-61 G3DSA:3.40.47.10 [270-419]  3.80000000000003e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-258]  4.10001399699315e-65 SSF53901 [220-418]  8.70005082121737e-67 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-18]  0.941 Signal
Eukaryota   
TMHMM No significant hit