close all open/close all

CDS information : Enter_00100


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction10,083 / 11,306 / + [in whole cluster]
10,083 / 11,306 / + [in contig]
Location10083..11306 [in whole cluster]
10083..11306 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)putative keto synthase beta EncB
Gene
Gene (GenBank)encB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[15123240] Context-dependent behavior of the enterocin iterative polyketide synthase; a new model for ketoreduction. (Chem Biol. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionPKS/NRPS Module

CLF3..363

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [putative keto synthase beta EncB]
MSTDIVITGMGVTAPTGLSVKEYWNATLAGTQGIAPLQEFDPTPYTARLAGQITGFEAKR
HLPGRLLPQTDRVTRLALVAADRALEDAQVDVGELGTYECGVVTSNATGGFEFSHREMQR
LWTQGPDRVSVYQCFAWFYAVNTGQISIRHKMRGPGGVVVAEQAGGLDAIGHARRTITRG
RSRLMVTGGVESSFDPWGWVSHLASGTVSTATDPATAYLPFDQRACGYVPGEGGALLVME
DAQSARGRTDRRPYGKITGYAATFDPAPGAQRPSGLRRAVDLALADAGLKPDAIDLVVAD
AAGVADLDAQEADALRAVFGPYGVPVCAPKTMVGRLMAGGGPLDVVCALLALRDNVIPPA
VNVTDVVDDYQIDLVRDEPRTCPLSRALVLARGAGGFNSAVIVEHTP
selected fasta
>polyketide synthase chain length factor subunit [putative keto synthase beta EncB]
ATGAGCACCGATATCGTGATCACCGGGATGGGTGTGACCGCGCCTACCGGCCTGAGCGTC
AAGGAGTACTGGAACGCCACCCTGGCCGGCACCCAGGGCATCGCCCCGCTGCAGGAGTTC
GATCCCACGCCGTACACGGCGCGGCTGGCCGGGCAGATCACCGGCTTCGAGGCCAAGAGG
CACCTGCCCGGGCGGCTGCTGCCGCAGACCGACCGCGTCACCCGGCTCGCCCTGGTCGCC
GCCGACCGCGCGCTTGAGGACGCCCAGGTCGACGTCGGCGAACTCGGCACCTACGAGTGC
GGTGTCGTCACCTCGAACGCGACCGGCGGCTTCGAGTTCTCCCACCGCGAGATGCAGCGG
CTGTGGACGCAGGGCCCCGATCGCGTCAGCGTCTACCAGTGCTTCGCCTGGTTCTACGCC
GTCAACACCGGCCAGATCTCCATCCGGCACAAGATGCGTGGCCCGGGCGGCGTGGTCGTC
GCCGAACAGGCAGGCGGCCTCGATGCGATCGGGCACGCCCGCCGCACGATCACCCGCGGC
CGCAGCCGCCTGATGGTCACCGGCGGCGTCGAGTCCTCCTTCGACCCATGGGGCTGGGTG
TCCCACCTGGCCTCCGGCACCGTCAGCACGGCCACCGACCCCGCCACCGCCTACCTGCCG
TTCGACCAGCGGGCCTGCGGCTATGTGCCGGGAGAAGGCGGTGCCCTCCTCGTCATGGAG
GACGCCCAATCGGCGCGCGGACGCACCGACCGGCGTCCCTACGGAAAGATCACCGGCTAC
GCGGCGACCTTCGACCCCGCCCCCGGAGCGCAGCGGCCCTCCGGTCTGCGGCGCGCCGTG
GACCTGGCTCTGGCGGATGCGGGGCTTAAGCCCGACGCCATCGACCTCGTCGTCGCCGAC
GCGGCAGGCGTCGCCGACCTCGACGCCCAGGAAGCCGATGCCCTGCGGGCCGTCTTCGGC
CCGTACGGCGTCCCCGTCTGTGCGCCCAAGACCATGGTCGGTCGCCTGATGGCCGGCGGA
GGGCCACTCGATGTGGTGTGCGCCCTGCTCGCGCTGCGCGACAACGTCATCCCACCGGCC
GTCAACGTCACCGACGTCGTCGACGACTACCAGATCGACCTCGTCCGTGACGAGCCACGC
ACGTGCCCCCTGTCGAGGGCCCTCGTCCTCGCGCGCGGCGCCGGCGGCTTCAACTCGGCC
GTCATCGTCGAGCACACCCCCTGA
CLF3..363
CLF7..1089

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-243]  2.29999999999998e-54 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [254-363]  3.2e-23 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-258]  4.30000000000003e-54 G3DSA:3.40.47.10 [269-405]  9.20000000000001e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-250]  2.50000909916183e-63 SSF53901 [213-406]  2.50000909916183e-46 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit