close all open/close all

CDS information : Enter_00110


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction11,354 / 11,602 / + [in whole cluster]
11,354 / 11,602 / + [in contig]
Location11354..11602 [in whole cluster]
11354..11602 [in contig]
TypeCDS
Length249 bp (82 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)putative acyl carrier protein EncC
Gene
Gene (GenBank)encC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[15123240] Context-dependent behavior of the enterocin iterative polyketide synthase; a new model for ketoreduction. (Chem Biol. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)
[16448095] Priming type II polyketide synthases via a type II nonribosomal peptide synthetase mechanism. (J Am Chem Soc. , 2006)

close this sectionPKS/NRPS Module

ACP3..76

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein EncC]
MLSSDQLLQILSECSGDEQALAQGDDILDREFEVLGYDSLVLLETSAQLKHRYDIDIPED
VIRDLKTPRAVLEYVNVPASRN
selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein EncC]
ATGCTCAGCAGCGACCAGCTCCTGCAGATCCTCAGCGAGTGCTCCGGCGACGAGCAGGCC
CTCGCCCAGGGCGACGACATCCTCGACCGCGAGTTCGAGGTCCTCGGCTACGACTCCCTG
GTCCTGCTGGAGACCTCCGCCCAGCTCAAGCACCGCTACGACATCGACATCCCGGAGGAC
GTCATCCGGGACCTGAAGACACCGCGCGCCGTCCTGGAGTACGTCAACGTCCCCGCCAGC
AGGAACTGA
ACP3..76
ACP7..228

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [6-75]  3.9e-08 PF00550
PF00550   PP-binding
 [3-76]  PS50075
PS50075   ACP_DOMAIN
 [4-76]  7.80000016938413e-10 SSF47336
SSF47336   ACP_like
 [5-76]  1.8e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP
 [1-22]  0.131 Signal
Bacteria, Gram-positive   
 [1-22]  0.07 Signal
Eukaryota   
TMHMM No significant hit