close all open/close all

CDS information : Enter_00120


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction11,655 / 12,677 / + [in whole cluster]
11,655 / 12,677 / + [in contig]
Location11655..12677 [in whole cluster]
11655..12677 [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productacyl-ACP thioesterase
Product (GenBank)putative acyl transferase EncL
Gene
Gene (GenBank)encL
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)
Related Reference
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>acyl-ACP thioesterase [putative acyl transferase EncL]
MDAPTPHPCRPRPRVVLTFPGQGAQHARMAAGLYGVSKSFTSTMDHAFDAFGPAGRTLRE
GWLAATPPAAFDDISYAQPLLYAVNCAMGAMVTEAGLRPDVLLGHSVGELAAATLAGVFS
FDCGLRYLSEYIGVYRHAPRGGMLAVAASPREVEAHLVPGVVIGAVNAPRQVLLSAPEEA
LADVEAALRGAGITCSRARALQPFHHPVMRDVVTTYAGLLTRPPLHPPHTTLYSAYTGQE
LANELATDWQFWTGQPAEPVLFGPTLEHLLSSGPHLLVEAGPGQSLTALARRTPAVARGD
AKALALLPARAGEPDADIEAVRAALKQLATCGCDPLSPDF
selected fasta
>acyl-ACP thioesterase [putative acyl transferase EncL]
ATGGATGCCCCCACCCCACACCCCTGTCGGCCGCGCCCCAGAGTCGTTCTCACCTTCCCC
GGCCAAGGGGCACAGCACGCCCGCATGGCCGCCGGCCTCTACGGCGTCTCCAAGTCCTTC
ACCTCCACGATGGACCACGCCTTCGACGCCTTCGGACCGGCGGGACGCACACTGCGCGAA
GGATGGCTCGCGGCCACACCACCCGCGGCCTTCGACGACATCTCCTATGCCCAGCCCCTG
CTGTACGCGGTCAACTGCGCGATGGGCGCCATGGTCACCGAGGCCGGTCTGCGCCCCGAC
GTCCTGCTGGGCCACAGTGTGGGGGAACTGGCCGCCGCCACCCTGGCCGGCGTGTTCTCC
TTCGACTGCGGCCTGCGCTACCTGTCCGAATACATCGGCGTCTACCGGCACGCCCCGCGC
GGCGGCATGCTTGCCGTGGCCGCCAGCCCCAGGGAGGTCGAAGCCCACCTGGTGCCGGGC
GTGGTCATCGGCGCCGTCAACGCACCGCGCCAGGTTCTGCTCTCCGCCCCGGAAGAGGCC
CTGGCCGACGTGGAAGCCGCCCTCCGTGGTGCCGGTATCACCTGTTCCCGCGCCCGCGCC
CTGCAGCCCTTCCACCACCCGGTGATGCGCGACGTCGTCACGACCTACGCGGGCTTGCTC
ACCCGTCCGCCCCTCCACCCGCCTCACACCACCCTCTACTCCGCCTACACCGGGCAGGAA
CTTGCCAACGAGCTCGCCACCGACTGGCAGTTCTGGACCGGTCAGCCCGCCGAGCCGGTC
CTGTTCGGCCCCACCCTGGAGCATCTGCTGAGCAGTGGCCCTCACCTCTTGGTCGAGGCA
GGCCCTGGACAGAGCCTGACCGCCCTGGCACGGCGCACGCCCGCGGTTGCCCGCGGTGAC
GCGAAGGCCCTCGCCCTGCTGCCGGCCCGCGCGGGCGAGCCGGACGCCGATATCGAAGCC
GTACGGGCCGCCCTGAAGCAACTCGCCACCTGCGGATGCGACCCGCTGTCTCCGGACTTC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [11-138]  6.80000000000006e-44 G3DSA:3.40.366.10 [202-296]  6.80000000000006e-44 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [18-327]  6.19999999999994e-38 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [14-294]  1.40000506907309e-42 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [139-193]  3.70000251046782e-09 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP
 [1-27]  0.456 Signal
Bacteria, Gram-negative   
 [1-27]  0.46 Signal
Bacteria, Gram-positive   
TMHMM No significant hit