close all open/close all

CDS information : Enter_00130


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction12,734 / 14,128 / + [in whole cluster]
12,734 / 14,128 / + [in contig]
Location12734..14128 [in whole cluster]
12734..14128 [in contig]
TypeCDS
Length1,395 bp (464 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productoxidoreductase
Product (GenBank)putative FAD-dependent oxygenase EncM
Gene
Gene (GenBank)encM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)
[24162851] Flavin-mediated dual oxidation controls an enzymatic Favorskii-type rearrangement. (Nature. , 2013)
[26067765] Biochemical Establishment and Characterization of EncM's Flavin-N5-oxide Cofactor. (J Am Chem Soc. , 2015)

close this sectionSequence

selected fasta
>oxidoreductase [putative FAD-dependent oxygenase EncM]
MQFPQLDPATLAAFSAAFRGELIWPSDADYDEARRIWNGTIDRRPALIARCTSTPDVVAA
VSFARKSGLLVAVRGGGHSMAGHSVCDGGIVIDLSLMNSIKVSRRLRRARAQGGCLLGAF
DTATQAHMLATPAGVVSHTGLGGLVLGGGFGWLSRKYGLSIDNLTSVEIVTADGGVLTAS
DTENPDLFWAVRGGGGNFGVVTAFEFDLHRVGPVRFASTYYSLDEGPQVIRAWRDHMATA
PDELTWALYLRLAPPLPELPADMHGKPVICAMSCWIGDPHEGERQLESILHAGKPHGLTK
ATLPYRALQAYSFPGAVVPDRIYTKSGYLNELSDEATDTVLEHAADIASPFTQLELLYLG
GAVARVPDDATAYPNRQSPFVTNLAAAWMDPTEDARHTAWAREGYRALAGHLSGGYVNFM
NPGEADRTREAYGAAKFERLQGVKAKYDPTNLFRLNQNIPPSSP
selected fasta
>oxidoreductase [putative FAD-dependent oxygenase EncM]
ATGCAGTTCCCACAGCTCGACCCTGCCACCCTGGCCGCGTTCAGCGCGGCGTTCCGGGGG
GAGTTGATCTGGCCGAGCGACGCCGACTACGACGAGGCGCGCCGCATCTGGAACGGCACG
ATCGACCGGCGCCCCGCGCTGATCGCCCGCTGCACCAGCACCCCGGACGTGGTCGCTGCG
GTGAGCTTCGCCCGCAAGAGCGGCCTGCTGGTCGCGGTCCGCGGCGGCGGACACAGCATG
GCCGGGCACTCGGTATGCGACGGCGGGATCGTCATCGATCTCTCCTTGATGAACAGCATC
AAGGTCAGCCGCCGCCTGCGGCGCGCGCGAGCCCAGGGCGGCTGCCTGCTGGGGGCGTTC
GACACCGCCACACAGGCCCACATGCTCGCCACCCCCGCCGGCGTGGTCTCCCACACCGGA
TTGGGGGGACTCGTCCTCGGCGGCGGATTCGGCTGGCTGAGCCGCAAGTACGGCCTGTCC
ATCGACAACCTCACCTCCGTGGAGATCGTTACCGCGGACGGCGGCGTCCTCACTGCGAGC
GACACCGAGAACCCCGACCTGTTCTGGGCCGTCCGCGGCGGCGGCGGCAACTTCGGTGTG
GTGACCGCATTCGAGTTCGACCTCCACCGGGTCGGGCCCGTCCGTTTCGCCAGCACCTAC
TACTCGCTGGACGAAGGACCCCAGGTCATCCGGGCCTGGCGCGACCATATGGCCACCGCC
CCCGACGAACTGACCTGGGCGTTGTATCTGCGCCTGGCACCGCCGCTGCCCGAACTGCCC
GCCGACATGCACGGCAAGCCGGTGATCTGCGCCATGAGCTGCTGGATCGGGGACCCGCAC
GAGGGTGAGCGGCAGCTTGAGTCCATCCTTCACGCCGGCAAGCCCCACGGTCTGACCAAG
GCGACTTTGCCCTACCGGGCCCTGCAGGCGTACTCCTTTCCCGGCGCCGTCGTCCCCGAC
CGGATCTACACCAAGAGCGGCTATCTGAACGAACTGAGCGATGAAGCCACCGACACGGTC
CTGGAACACGCCGCCGACATCGCCTCCCCCTTCACTCAGCTCGAACTGCTCTACCTGGGC
GGGGCCGTGGCGCGCGTGCCCGACGACGCCACCGCCTACCCCAACCGCCAGTCGCCGTTC
GTGACCAACCTGGCCGCCGCCTGGATGGACCCCACCGAGGACGCCCGCCACACCGCCTGG
GCCCGCGAGGGCTACCGGGCCCTGGCCGGCCACTTGTCCGGCGGCTACGTCAACTTCATG
AACCCGGGCGAGGCGGACCGCACGCGGGAGGCTTACGGGGCCGCCAAGTTCGAACGGTTG
CAGGGCGTCAAGGCCAAGTACGACCCGACGAATCTGTTCCGCCTCAACCAGAACATACCC
CCGAGCAGCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006093 Oxygen oxidoreductase covalent FAD-binding site (Binding_site)
 [45-78]  PS00862
PS00862   OX2_COVAL_FAD
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [45-180]  2.70000000000002e-33 PF01565
PF01565   FAD_binding_4
IPR012951 Berberine/berberine-like (Domain)
 [416-460]  4.1e-14 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [16-211]  4.50001022902825e-56 SSF56176
SSF56176   FAD-binding_2
 [41-211]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [9-98]  9.10000000000001e-12 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [100-210]  9.8e-16 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP No significant hit
TMHMM No significant hit