close all open/close all

CDS information : Enter_00140


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction14,240 / 15,808 / + [in whole cluster]
14,240 / 15,808 / + [in contig]
Location14240..15808 [in whole cluster]
14240..15808 [in contig]
TypeCDS
Length1,569 bp (522 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productbenzoyl-ACP synthetase
benzoate--CoA ligase
benzoate--ACP ligase
Product (GenBank)putative aryl-CoA ligase EncN
Gene
Gene (GenBank)encN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[12511484] Characterization of benzoyl coenzyme A biosynthesis genes in the enterocin-producing bacterium "Streptomyces maritimus". (J Bacteriol. , 2003)
[12889947] Mutasynthesis of enterocin and wailupemycin analogues. (J Am Chem Soc. , 2003)
[16448095] Priming type II polyketide synthases via a type II nonribosomal peptide synthetase mechanism. (J Am Chem Soc. , 2006)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)
[19215142] In vitro biosynthesis of unnatural enterocin and wailupemycin polyketides. (J Nat Prod. , 2009)

close this sectionSequence

selected fasta
>benzoyl-ACP synthetase [putative aryl-CoA ligase EncN]
MTTDLFNLSTLVDQHLDSGLSDKAALYSPHGHVSYGELYRSMCAMGRALRELGIQREQRV
LLILDDTPAFFTAFLGAGRIGAVPVPINYQTDPEQVRFYAQDSYARAAVIEAVRYEELAP
ALQEAGVMVISTEPAGPDDGRLHMRDLIRGHEGELGAASTHAEDPALWLYSSGSTGRPKG
VVHLQRDIAPACRHYAGDVLGVTQDDVHLSTTKLFHAYGLGNSLLFPLWFGGTCVLLPGF
PAPHLVLETIERVRPTLLFSVPALYNAMPRSPGAGSRDLSSIRLCVSAAESLPAHVWERW
RDLYGLTILDGVGSTEMLHIYCSNTERALRPGSSGRAVPGYQIKLVDPDGGDVEGAGSGE
MFVRGGSMLAQYWHRADQTRSVLKGSWYRTGDRYRRDEDGFYWYEGRADDMMKVSGLWVA
PAAIETALQQHPDVAEAAVVGVDTDRLTRIKAFIVLRDGCQGSDALARQLRQWCKDRLAS
HQFPHLVEFAADLPKTPTGKIQRFALRSQETVKADAPAAHAV
selected fasta
>benzoyl-ACP synthetase [putative aryl-CoA ligase EncN]
ATGACCACCGACCTCTTCAACCTCTCCACCCTGGTCGACCAGCATCTCGACAGCGGCCTG
AGCGACAAGGCCGCCCTCTACAGCCCCCACGGCCACGTCAGCTACGGCGAGCTGTACCGG
AGCATGTGTGCGATGGGCCGGGCTCTGCGTGAGCTTGGCATCCAGCGCGAACAGCGCGTC
CTGCTCATCCTGGACGACACCCCGGCGTTCTTCACCGCCTTCCTCGGCGCCGGCCGCATC
GGCGCTGTCCCGGTCCCGATCAACTACCAAACCGACCCTGAACAGGTGCGTTTCTACGCC
CAGGACAGTTACGCCCGGGCGGCTGTGATCGAGGCGGTCCGGTACGAGGAGCTCGCGCCC
GCTCTGCAGGAGGCCGGCGTGATGGTGATCAGCACCGAGCCCGCAGGGCCGGACGACGGC
AGGCTCCACATGCGCGACCTGATCCGCGGCCACGAGGGCGAGCTGGGCGCCGCGTCCACA
CACGCCGAGGATCCCGCGCTGTGGCTGTACAGCTCCGGGTCCACCGGACGGCCCAAAGGG
GTGGTTCACCTGCAGCGGGACATCGCACCCGCCTGCCGGCACTACGCGGGCGATGTCCTG
GGTGTCACTCAGGACGACGTGCACCTGTCCACCACCAAGCTCTTCCACGCCTACGGCCTG
GGCAACAGCCTGCTGTTTCCGCTGTGGTTCGGCGGGACATGCGTCCTGCTGCCCGGGTTT
CCGGCACCGCACCTCGTGCTGGAGACCATCGAACGAGTACGTCCCACGCTGCTGTTCTCC
GTCCCGGCCTTGTACAACGCCATGCCCCGCTCGCCCGGCGCCGGCTCTCGGGACCTGTCG
TCCATCCGGCTGTGCGTCTCGGCCGCCGAGAGCCTGCCCGCCCACGTCTGGGAACGATGG
CGCGACCTTTACGGGCTGACGATCCTGGACGGTGTGGGGTCCACCGAAATGCTGCACATC
TACTGCAGCAACACCGAGCGGGCGCTTCGCCCCGGCTCCTCCGGGAGGGCCGTGCCCGGC
TACCAGATCAAGCTCGTCGACCCCGACGGCGGCGATGTGGAAGGCGCGGGCAGCGGAGAG
ATGTTCGTGCGGGGCGGCAGCATGCTGGCCCAGTACTGGCACCGTGCCGACCAGACCCGC
TCGGTGTTGAAGGGGAGCTGGTACCGCACCGGCGACCGCTACCGCCGCGACGAGGACGGC
TTCTACTGGTACGAGGGACGTGCCGACGACATGATGAAGGTCTCCGGGCTGTGGGTCGCT
CCCGCCGCGATCGAGACCGCCCTTCAGCAGCACCCGGATGTTGCCGAGGCAGCGGTCGTC
GGCGTGGACACCGACCGCCTCACCCGGATCAAGGCGTTCATCGTGCTGCGCGACGGTTGC
CAGGGCAGCGACGCACTGGCCCGGCAGCTGCGGCAGTGGTGCAAGGACCGTCTGGCCAGT
CATCAGTTTCCGCACCTGGTCGAGTTCGCCGCGGACCTGCCCAAGACGCCTACGGGCAAG
ATCCAGCGGTTCGCCCTGCGCTCACAGGAGACGGTAAAGGCGGATGCTCCGGCCGCCCAC
GCCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [34-439]  1.60000000000002e-96 PF00501
PF00501   AMP-binding
IPR011957 Benzoate-CoA ligase family (Family)
 [9-508]  TIGR02262
TIGR02262   Benz_CoA_lig
IPR025110 Domain of unknown function DUF4009 (Domain)
 [484-511]  1.3e-08 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit