close all open/close all

CDS information : Enter_00150


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction16,242 / 15,850 / - [in whole cluster]
16,242 / 15,850 / - [in contig]
Locationcomplement(15850..16242) [in whole cluster]
complement(15850..16242) [in contig]
TypeCDS
Length393 bp (130 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)EncO
Gene
Gene (GenBank)encO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [EncO]
MTTTLAEQAVTDFVREWSTAEERGEHRALDDLLAKDFVGVGPRGFVRSREEWLARNSTGT
VRNTSFEVSDLRIRSYGETAVVVAAQTQQSVNGDADASGAFRFTLIVVRQDGRLRLAGLH
LSPNAVPAGG
selected fasta
>hypothetical protein [EncO]
ATGACGACCACGCTGGCCGAGCAGGCGGTTACGGACTTCGTCCGGGAATGGAGCACGGCC
GAAGAGCGGGGAGAGCACAGGGCGCTGGACGACCTGCTCGCGAAGGACTTCGTCGGCGTC
GGGCCCCGGGGCTTCGTGCGCAGCCGCGAGGAGTGGCTGGCCCGCAACAGCACGGGCACC
GTGCGCAACACGTCGTTTGAGGTGAGCGACCTGCGTATCCGCTCCTACGGGGAGACGGCG
GTCGTGGTGGCGGCCCAGACCCAGCAGAGCGTGAACGGTGATGCCGACGCCAGTGGTGCG
TTCCGCTTCACGCTCATCGTCGTCCGCCAGGACGGGCGGCTGCGGCTCGCCGGCCTGCAC
CTGAGCCCGAACGCCGTCCCGGCAGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit