close all open/close all

CDS information : Enter_00160


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction17,840 / 16,269 / - [in whole cluster]
17,840 / 16,269 / - [in contig]
Locationcomplement(16269..17840) [in whole cluster]
complement(16269..17840) [in contig]
TypeCDS
Length1,572 bp (523 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productphenylalanine ammonia-lyase
Product (GenBank)putative phenylalanine ammonia lyase EncP
Gene
Gene (GenBank)encP
EC number4.3.1.24
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[12082112] Inactivation, complementation, and heterologous expression of encP, a novel bacterial phenylalanine ammonia-lyase gene. (J Biol Chem. , 2002)
[26390197] The Bacterial Ammonia Lyase EncP: A Tunable Biocatalyst for the Synthesis of Unnatural Amino Acids. (J Am Chem Soc. , 2015)

close this sectionSequence

selected fasta
>phenylalanine ammonia-lyase [putative phenylalanine ammonia lyase EncP]
MTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSM
GGFVDHLVPVSQARQLQENLINAVATNVGAYLDDTTARTIMLSRIVSLARGNSAITPANL
DKLVAVLNAGIVPCIPEKGSLGTSGDLGPLAAIALVCAGQWKARYNGQIMPGRQALSEAG
VEPMELSYKDGLALINGTSGMVGLGTMVLQAARRLVDRYLQVSALSVEGLAGMTKPFDPR
VHGVKPHRGQRQVASRLWEGLADSHLAVNELDTEQTLAGEMGTVAKAGSLAIEDAYSIRC
TPQILGPVVDVLDRIGATLQDELNSSNDNPIVLPEEAEVFHNGHFHGQYVAMAMDHLNMA
LATVTNLANRRVDRFLDKSNSNGLPAFLCREDPGLRLGLMGGQFMTASITAETRTLTIPM
SVQSLTSTADFQDIVSFGFVAARRAREVLTNAAYVVAFELLCACQAVDIRGADKLSSFTR
PLYERTRKIVPFFDRDETITDYVEKLAADLIAGEPVDAAVAAH
selected fasta
>phenylalanine ammonia-lyase [putative phenylalanine ammonia lyase EncP]
ATGACCTTCGTCATAGAGCTCGACATGAACGTCACGCTCGACCAACTTGAGGACGCGGCG
CGACAGCGCACGCCCGTGGAGCTGTCCGCACCCGTCCGCTCCCGCGTCCGCGCCTCGCGC
GACGTGTTGGTGAAGTTCGTGCAGGACGAACGTGTCATCTACGGGGTCAACACCAGCATG
GGGGGCTTCGTCGACCACCTCGTCCCGGTGTCCCAGGCCCGGCAGCTCCAGGAGAACCTG
ATCAACGCGGTCGCCACCAACGTGGGGGCGTATCTGGACGACACGACCGCCCGGACCATC
ATGCTGTCCCGCATCGTGTCGCTGGCGCGCGGGAACTCCGCGATCACCCCGGCGAATCTG
GACAAGCTGGTGGCCGTACTCAACGCCGGGATCGTGCCGTGCATCCCGGAGAAGGGCTCT
TTGGGCACCAGCGGTGACCTCGGCCCGCTGGCCGCGATCGCCCTGGTGTGCGCGGGGCAG
TGGAAGGCCCGCTACAACGGTCAGATCATGCCCGGGCGGCAGGCCCTGTCCGAGGCCGGC
GTCGAGCCGATGGAGCTGAGCTACAAGGATGGCCTGGCCCTGATCAACGGCACGTCAGGC
ATGGTCGGCCTGGGCACCATGGTCCTCCAGGCCGCGCGCCGGCTCGTGGACCGCTACCTG
CAGGTGTCCGCGTTGTCGGTCGAGGGCCTGGCAGGCATGACGAAACCGTTCGACCCTCGC
GTGCACGGCGTCAAGCCGCACCGCGGGCAGCGTCAGGTGGCCTCGCGGTTGTGGGAGGGG
CTTGCCGACTCGCACCTGGCGGTCAACGAACTGGACACCGAGCAGACCCTGGCCGGAGAG
ATGGGCACGGTCGCCAAGGCCGGTTCGCTGGCGATCGAGGACGCCTACTCCATCCGGTGC
ACGCCGCAGATCCTCGGTCCCGTGGTCGATGTGCTGGACCGGATCGGGGCGACCCTGCAG
GACGAGCTGAACTCCTCCAACGACAACCCGATCGTCCTGCCGGAGGAGGCGGAGGTGTTC
CACAACGGGCACTTCCACGGCCAGTACGTGGCCATGGCCATGGACCACCTGAACATGGCC
CTGGCCACCGTGACCAATCTCGCCAACCGGCGCGTGGACCGCTTCCTGGACAAGAGCAAC
AGCAACGGGCTGCCCGCCTTCCTGTGCCGGGAAGATCCGGGACTGCGCCTGGGCCTGATG
GGCGGCCAGTTCATGACCGCGTCGATCACCGCGGAGACCCGCACCCTGACCATTCCGATG
TCGGTGCAGTCCCTCACGAGTACGGCGGACTTCCAGGACATCGTGTCCTTCGGATTCGTC
GCCGCCCGCCGCGCCCGGGAGGTACTCACCAACGCTGCCTACGTGGTGGCCTTCGAGCTG
CTGTGCGCCTGCCAGGCCGTCGACATCCGCGGCGCGGACAAACTGTCCTCCTTCACCCGC
CCGCTCTATGAGCGCACCCGCAAGATCGTGCCGTTCTTCGACCGGGACGAGACCATCACC
GACTACGTCGAGAAGCTGGCGGCCGACCTGATCGCGGGCGAGCCCGTCGACGCTGCCGTG
GCGGCGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001106 Aromatic amino acid lyase (Family)
 [10-494]  PF00221
PF00221   Lyase_aromatic
IPR008948 L-Aspartase-like (Domain)
 [8-519]  SSF48557
SSF48557   L-Aspartase-like
IPR024083 L-Aspartase-like, N-terminal (Domain)
 [10-197]  7.29999999999999e-63 G3DSA:1.10.275.10
G3DSA:1.10.275.10   G3DSA:1.10.275.10
SignalP No significant hit
TMHMM No significant hit