close all open/close all

CDS information : Enter_00170


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction18,390 / 18,145 / - [in whole cluster]
18,390 / 18,145 / - [in contig]
Locationcomplement(18145..18390) [in whole cluster]
complement(18145..18390) [in contig]
TypeCDS
Length246 bp (81 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)putative ferredoxin EncQ
Gene
Gene (GenBank)encQ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
Related Reference
ACC
P29603
PmId
[8045914] Cloning, expression, and molecular characterization of the gene encoding an extremely thermostable [4Fe-4S] ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus. (J Bacteriol. , 1994)

close this sectionSequence

selected fasta
>putative ferredoxin [putative ferredoxin EncQ]
MVTGESAAAGRWRLAVDATLCIGSGACAGSSAHFRMTQDGHAEPREDVIVADDTARDAAE
CCPVEAITVSDTSTGELIAPA
selected fasta
>putative ferredoxin [putative ferredoxin EncQ]
GTGGTGACCGGGGAGTCTGCGGCTGCAGGCCGTTGGCGGCTGGCGGTGGACGCGACGTTG
TGCATCGGATCGGGTGCGTGTGCCGGTTCCTCTGCCCATTTCCGGATGACGCAGGACGGC
CACGCCGAGCCGCGCGAGGACGTCATCGTCGCCGATGACACGGCACGGGACGCCGCGGAG
TGTTGCCCGGTGGAGGCCATCACGGTGTCCGACACCAGTACCGGCGAGTTGATCGCACCG
GCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-32]  0.829 Signal
Eukaryota   
 [1-28]  0.326 Signal
Bacteria, Gram-negative   
TMHMM No significant hit