close all open/close all

CDS information : Enter_00190


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction20,329 / 19,682 / - [in whole cluster]
20,329 / 19,682 / - [in contig]
Locationcomplement(19682..20329) [in whole cluster]
complement(19682..20329) [in contig]
TypeCDS
Length648 bp (215 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative regulatory protein EncS
Gene
Gene (GenBank)encS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative regulatory protein EncS]
MPKRVDHAQRRAHIADALVRVAARDGLHAVTMRAVAAEAGMSLNLVQYYFDTKAQLMHAA
LQHLEQQSHERWSARLESLEDPGSARACLEAFVDEALPVDADSHTFRLVWTSYAVLAMTD
PELAEQPFVEGPNRLERQLTHILATAQAAGEIAAYLDVSAEAARLLSLSHGVGTSVLVGQ
RSAAQARYVMLYHLSRLFNDPTPPEAPGQHLAAAS
selected fasta
>putative TetR family transcriptional regulator [putative regulatory protein EncS]
GTGCCGAAACGTGTTGACCATGCCCAGCGCCGGGCGCACATCGCTGACGCCCTGGTCCGG
GTGGCCGCGCGGGACGGACTGCATGCGGTGACCATGCGCGCGGTCGCGGCCGAGGCGGGC
ATGTCCTTGAACCTGGTGCAGTACTACTTCGACACCAAGGCCCAGTTGATGCACGCCGCT
CTGCAGCACCTTGAGCAGCAGAGCCACGAGCGGTGGTCGGCGCGGCTGGAGAGCCTGGAG
GATCCGGGGTCGGCACGGGCCTGTCTCGAAGCGTTCGTGGATGAAGCCCTGCCGGTCGAC
GCGGACAGCCACACCTTCCGGCTGGTGTGGACGTCCTACGCGGTACTGGCCATGACCGAC
CCCGAGCTGGCGGAGCAGCCCTTCGTCGAGGGGCCGAACCGGCTTGAGCGACAGCTCACC
CACATCCTGGCCACGGCGCAGGCGGCGGGAGAGATCGCGGCTTATCTGGATGTCTCCGCC
GAGGCCGCGCGTCTGCTGAGCCTCAGTCACGGTGTCGGGACCAGCGTGCTGGTCGGGCAG
CGGTCGGCGGCACAAGCCCGGTACGTGATGCTCTACCACCTCTCCCGCTTGTTCAACGAC
CCCACTCCACCCGAGGCCCCTGGCCAGCACTTAGCGGCAGCTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [8-68]  PS50977
PS50977   HTH_TETR_2
 [15-59]  2.7e-10 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-80]  8.20001307135067e-17 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [82-205]  1.20000117458134e-18 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [1-187]  4.70000000000001e-31 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-36]  0.255 Signal
Bacteria, Gram-positive   
TMHMM No significant hit